TkA07G410820 | RubberDandelionOmics

Gene overview

TkA07G410820

Reference: TK1151 Chr: Chr07 Coordinates: 103748272-103764194 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2371 bp · TkA07G410820|TK1151|cDNA

AGATTGAATCTTACCACGTCTACTGATCGAGATCAAAAGGTTCGTTAGTTTCCGTCTGTCGACGTAATTACAGATCATGGGAGATTTGGAGCTGATTGTAGATCGACTAAAATTCACACAACCATGCCGATTGATCAACTTTTAAATAATAGATATTGTAATCGAAGAACGTGAACGACGTGGTGGATTTCCAGTCCATGCTTCCTCCGTCGACTCCCCCACCGTTTTATATCTGATTATCTCGGCGTTTCTTTCCGTCT...

CDS

Download CDS FASTA

1695 bp · TkA07G410820|TK1151|CDS

ATGCTAATCGCTTATCCATGGCAACGTGTTCGCAAGGGTAGTGTTTTGAATTTAAAATTGCGTGGCCAGATATCTGATCAGGTGAAGACTCGTTTCTCTTCAGGGCTATCCTTACCTCAAATCTGTGAAAACCTGATCAAGGCAGCATATGATCCTCGTATATCCGGCGTTTATCTCCACATCGAAACCCTAAATTGCGGATGGGGTAAAATTGAAGAAATTCGAAGGCACATATTGGATTTTAGGAAGTCAGGAAAGTT...

Protein

Download Protein FASTA

564 aa · TkA07G410820|TK1151|PROTEIN

MLIAYPWQRVRKGSVLNLKLRGQISDQVKTRFSSGLSLPQICENLIKAAYDPRISGVYLHIETLNCGWGKIEEIRRHILDFRKSGKFIIGYAPLWSEKEYYLGCACEELYAPPSAYFSLYGLTASASFLGGVLEKIGVEPQVQRIGKYKSAGDQLIRKNISEENREVLTTLVDNIYGNWVDKISESKGKKKEDIESFINEGVYQIGKLKEDGWITDIKYDDEVTSMLKTKLGIAEDKKLPLVDYKKYSRVRKWTLGLTGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G410820`
TK1151 ID	TkA07G410820
OH-1004 ID	LXL04_030552
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.277 / OH-1004 35.467 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G410820

Location Chr07:103748272-103764194 (+)

Description Similar to SPPA: Serine protease SPPA, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73990`	Serine protease that may be involved in the light-dependent degradation of antenna and photosystem II in chloroplasts.	Identification and characterization of SppA, a novel light-inducible chloroplast protease complex associated with thylakoid membranes.2001 · DOI: 10.1074/jbc.m100506200 Loss of chloroplast protease SPPA function alters high light acclimation processes in Arabidopsis thaliana L. (Heynh.).2009 · DOI: 10.1093/jxb/erp051

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030552 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0006465 signal peptide processing Biological Process

GO:0009451 RNA modification Biological Process

GO:0009642 response to light intensity Biological Process

GO:0031425 chloroplast RNA processing Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G18485

ath:AT1G73990

ath:AT3G03580

ath:AT3G63370

ath:AT4G21300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.263

Rank 1 · TkA07G410820 · TK1151

Cytoplasm0.218

Rank 2 · TkA07G410820 · TK1151

Endoplasmic reticulum0.178

Rank 3 · TkA07G410820 · TK1151

Peroxisome0.168

Rank 4 · TkA07G410820 · TK1151

Plastid0.090

Rank 5 · TkA07G410820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01343Peptidase_S4982-231 aa

PF00574CLP_protease288-358 aa

PF25145NfeD1b_N290-377 aa

PF01972SDH_protease295-371 aa

PF01343Peptidase_S49332-483 aa

PF00574CLP_protease443-467 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G410820	`PF01343`	Peptidase_S49	82	231	2.3e-62	210.3
TkA07G410820	`PF00574`	CLP_protease	288	358	0.0071	17.0
TkA07G410820	`PF25145`	NfeD1b_N	290	377	0.00017	21.9
TkA07G410820	`PF01972`	SDH_protease	295	371	0.012	15.4
TkA07G410820	`PF01343`	Peptidase_S49	332	483	2.3e-62	210.3
TkA07G410820	`PF00574`	CLP_protease	443	467	0.0071	17.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9C0`	Arabidopsis thaliana	sp\|Q9C9C0\|SPPA1_ARATH Serine protease SPPA, chloroplastic	72.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card