TkA07G410560 | RubberDandelionOmics

Gene overview

TkA07G410560

Reference: TK1151 Chr: Chr07 Coordinates: 103680182-103682608 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1813 bp · TkA07G410560|TK1151|cDNA

CTTTTGGCTTTTCGGACCCAAGATCGCCACCTAACGGCTAACACCAAAAGCCGTTAAATTAAAAACACTCTTGCGATCGCCGCCACCTACGGCGGACTTTCCCATTCTTCCTCCATTGATATACCCCTCCTTATACCATTTCCTCAATTCTCTCACTTTCTCTAGACTTCCGTCTTCTTACAATGGCATTAGCACCTCCCGCCACCTCACTTTCAAAATCCTTTTTCTCTTCCAATCCCTCAACATCCCCATCATCAGCT...

CDS

Download CDS FASTA

1476 bp · TkA07G410560|TK1151|CDS

ATGGCATTAGCACCTCCCGCCACCTCACTTTCAAAATCCTTTTTCTCTTCCAATCCCTCAACATCCCCATCATCAGCTCCTCCGCTTGTTAACCTACCGACCACCTCCCGTAAATCTTCTAGACAGTTCGTTGTACGGAACTCCGTTACGACTGCTCAGTCACCTTCCATTTCGTCGACTAGATCATCCACTGTGAAATCAGTGAAGGCGAGGCAGATCATTGACAGCAGGGGAAATCCGACGGTGGAGGTTGATCTCGT...

Protein

Download Protein FASTA

491 aa · TkA07G410560|TK1151|PROTEIN

MALAPPATSLSKSFFSSNPSTSPSSAPPLVNLPTTSRKSSRQFVVRNSVTTAQSPSISSTRSSTVKSVKARQIIDSRGNPTVEVDLVTDELYRSAVPSGASTGIYEALELRDGDKKVYGGKGVLNAVRNINEILGPKLIGVDVRNQADFDAIMLEIDGTPNKSKLGANAILGVSLSVCRAGAGAKGIPLYKHIQDISGTKELVMPVPAFNVINGGSHAGNNLAMQEFMILPVGATSFAEALQMGSEVYHTLKGIIKAKYG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G410560`
TK1151 ID	TkA07G410560
OH-1004 ID	LXL04_030548
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G410560

Location Chr07:103680182-103682608 (+)

Description Similar to ENO1: Enolase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74030`	Enolase 1, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030548 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006094 gluconeogenesis Biological Process

GO:0006096 glycolytic process Biological Process

GO:0007618 mating Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0042593 glucose homeostasis Biological Process

GO:0061621 canonical glycolysis Biological Process

GO:0000015 phosphopyruvate hydratase complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT1G74030

ddi:DDB_G0283137

dme:Dmel_CG17654

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.969

Rank 1 · TkA07G410560 · TK1151

Mitochondrion0.050

Rank 2 · TkA07G410560 · TK1151

Cytoplasm0.044

Rank 3 · TkA07G410560 · TK1151

Peroxisome0.036

Rank 4 · TkA07G410560 · TK1151

Nucleus0.017

Rank 5 · TkA07G410560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03952Enolase_N65-193 aa

PF00113Enolase_C202-489 aa

PF13378MR_MLE_C344-452 aa

PF07476MAAL_C369-452 aa

PF26847Phage_T5_AP_Endonuclease370-420 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G410560	`PF03952`	Enolase_N	65	193	1.3e-55	187.9
TkA07G410560	`PF00113`	Enolase_C	202	489	7.1e-147	489.1
TkA07G410560	`PF13378`	MR_MLE_C	344	452	7.4e-07	29.8
TkA07G410560	`PF07476`	MAAL_C	369	452	0.00054	19.9
TkA07G410560	`PF26847`	Phage_T5_AP_Endonuclease	370	420	0.23	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9C4`	Arabidopsis thaliana	sp\|Q9C9C4\|ENO1_ARATH Enolase 1, chloroplastic	90.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card