Gene Card
Gene overview
cDNA / CDS / Protein Sequences
582 bp · TkA07G400860|TK1151|cDNA
ATGCTATTGTTTCATTTCAAAACCTTAGTATGGAAGAGCACAAGGAATCTGAACTGGAATCGACGACCGAACTATCACAACAGGCGCCGCGTAGTTTGGAGGAGGTGGAAGAAAGGACAGGAGACAGGTTTAAGGATAAAAGATAAAGAGCTGTTGAAGGAGGCTTTCACTGACCGCTCTTACATAAATCAGCGGCTGGAATACATAGGCGACTCTGTTTTAAATCTTTTGGTAGCTATTCTACATTACTTAGATTATCC...
582 bp · TkA07G400860|TK1151|CDS
ATGCTATTGTTTCATTTCAAAACCTTAGTATGGAAGAGCACAAGGAATCTGAACTGGAATCGACGACCGAACTATCACAACAGGCGCCGCGTAGTTTGGAGGAGGTGGAAGAAAGGACAGGAGACAGGTTTAAGGATAAAAGATAAAGAGCTGTTGAAGGAGGCTTTCACTGACCGCTCTTACATAAATCAGCGGCTGGAATACATAGGCGACTCTGTTTTAAATCTTTTGGTAGCTATTCTACATTACTTAGATTATCC...
Protein
Download Protein FASTA193 aa · TkA07G400860|TK1151|PROTEIN
MLLFHFKTLVWKSTRNLNWNRRPNYHNRRRVVWRRWKKGQETGLRIKDKELLKEAFTDRSYINQRLEYIGDSVLNLLVAILHYLDYPNLAPGGLTRLRSANVHTEALARAALKCNLDEFLRHQDLFSQNSNIVLLRIQIAEFRKNGRIRAETKYLNCETDDNEDVGFGDFDLRTAAAAMAVDGGLETGKGIGF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G400860 |
|---|---|
| TK1151 ID | TkA07G400860 |
| OH-1004 ID | LXL04_001870 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 67.000 |
| Protein coverage (%) | TK1151 42.487 / OH-1004 26.586Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G400860 |
|---|---|
| Location | Chr07:100753249-100753912 (-) |
| Description | Similar to Os06g0358800: Ribonuclease 3-like protein 3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000911 cytokinesis by cell plate formation Biological Process GO:0006364 rRNA processing Biological Process GO:0006396 RNA processing Biological Process GO:0009616 RNAi-mediated antiviral immune response Biological Process GO:0009880 embryonic pattern specification Biological Process GO:0009908 flower development Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0010267 ta-siRNA processing Biological Process GO:0010599 lsiRNA processing Biological Process GO:0030422 siRNA processing Biological Process GO:0031053 primary miRNA processing Biological Process GO:0035196 miRNA processing Biological Process |
| KEGG gene cross-reference | ath:AT1G01040 ath:AT3G20420 dosa:Os03g0121800 dosa:Os05g0271300 dosa:Os06g0358800 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14622Ribonucleas_3_348-123 aaPF00636Ribonuclease_364-127 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G400860 | PF14622 | Ribonucleas_3_3 | 48 | 123 | 6.1e-11 | 43.3 |
| TkA07G400860 | PF00636 | Ribonuclease_3 | 64 | 127 | 6.4e-15 | 56.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.