TkA07G400400 | RubberDandelionOmics

Gene overview

TkA07G400400

Reference: TK1151 Chr: Chr07 Coordinates: 100628660-100632281 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2082 bp · TkA07G400400|TK1151|cDNA

GTTGTATTGAGATTATAAAAAAACAGATTCGTTTTTCTCTTTCCAATCTCGTAAACTGATATTTGCTTTCATTACAAGTTACTAAAGCAAATGCGATTCTGAAATTGAAACATAGAGGTCGTCCGAAATGGAGAAGAAGAGCTGGTGGAAGCGGAAGTCCTCTGACCGGAGTCCCGGCGAGACAGAAAGTTCCACTTCAATATCTTCACATTCCGAAAGCAACTCCGACGAAAAGGGAGACCACGACAGCTTACAGAAAT...

CDS

Download CDS FASTA

1809 bp · TkA07G400400|TK1151|CDS

ATGGAGAAGAAGAGCTGGTGGAAGCGGAAGTCCTCTGACCGGAGTCCCGGCGAGACAGAAAGTTCCACTTCAATATCTTCACATTCCGAAAGCAACTCCGACGAAAAGGGAGACCACGACAGCTTACAGAAATCACAATCATCTGAAGTCACCTCAAGAGTTTCAACTCCAAACACAGAAACCAACGACAGTTATAAAAATCTGACAGAAAAGCTATCAGCGGCTCTTGTCAATGTTGGCGCTAAAGAAGATTTGGTCAA...

Protein

Download Protein FASTA

602 aa · TkA07G400400|TK1151|PROTEIN

MEKKSWWKRKSSDRSPGETESSTSISSHSESNSDEKGDHDSLQKSQSSEVTSRVSTPNTETNDSYKNLTEKLSAALVNVGAKEDLVKQHAKVAEEAVAGWEKAENEVTQLKQQLEAALQQNLALEVRTNHLDGALKECVKQLRQSREEQEQQINKWEITKKDLELQICNLKANSQVNKSVDPKLLQKLEALEKENSDLKSSLMDQSEELEIRTIERDLSTQAAESASKHQLESIKKVAKLEAECRKLTSLTRKSPSFYVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G400400`
TK1151 ID	TkA07G400400
OH-1004 ID	LXL04_030378
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G400400

Location Chr07:100628660-100632281 (-)

Description Similar to FPP: Filament-like plant protein (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05270`	Ensures, when in complex with COG2 and FPP2/VETH2, the correct secondary cell wall (SCW) deposition pattern by recruiting exocyst components to cortical microtubules in xylem cells during secondary cell wall deposition by recruiting EXO70A1.	No verified direct reference in this release
`At1g77580`	Filament-like plant protein 1.	No verified direct reference in this release
`At1g21810`	Ensures, when in complex with FPP3/VETH1 and COG2, the correct secondary cell wall (SCW) deposition pattern by recruiting exocyst components to cortical microtubules in xylem cells during secondary cell wall deposition by recruiting EXO70A1.	No verified direct reference in this release
`At1g19835`	Filament-like plant protein 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030378 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0060178 regulation of exocyst localization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0031410 cytoplasmic vesicle Cellular Component

GO:0030674 protein-macromolecule adaptor activity Molecular Function

KEGG gene cross-reference

ath:AT1G21810

ath:AT1G77580

ath:AT3G05270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.483

Rank 1 · TkA07G400400 · TK1151

Cell membrane0.325

Rank 2 · TkA07G400400 · TK1151

Nucleus0.275

Rank 3 · TkA07G400400 · TK1151

Plastid0.055

Rank 4 · TkA07G400400 · TK1151

Golgi apparatus0.055

Rank 5 · TkA07G400400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05911FPP24-76 aa

PF30677CCDC18_1st48-207 aa

PF05911FPP82-159 aa

PF21111CDI_toxin_EC869_like128-177 aa

PF05911FPP183-253 aa

PF21111CDI_toxin_EC869_like256-279 aa

PF05911FPP278-347 aa

PF21111CDI_toxin_EC869_like293-314 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G400400	`PF05911`	FPP	24	76	7.8e-65	220.4
TkA07G400400	`PF30677`	CCDC18_1st	48	207	1.7	8.6
TkA07G400400	`PF05911`	FPP	82	159	7.8e-65	220.4
TkA07G400400	`PF21111`	CDI_toxin_EC869_like	128	177	9.1	7.3
TkA07G400400	`PF05911`	FPP	183	253	7.8e-65	220.4
TkA07G400400	`PF21111`	CDI_toxin_EC869_like	256	279	9.1	7.3
TkA07G400400	`PF05911`	FPP	278	347	7.8e-65	220.4
TkA07G400400	`PF21111`	CDI_toxin_EC869_like	293	314	9.1	7.3
TkA07G400400	`PF05911`	FPP	340	509	7.8e-65	220.4
TkA07G400400	`PF30677`	CCDC18_1st	347	422	1.7	8.6
TkA07G400400	`PF21111`	CDI_toxin_EC869_like	424	478	9.1	7.3
TkA07G400400	`PF30677`	CCDC18_1st	430	506	1.7	8.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MA92`	Arabidopsis thaliana	sp\|Q9MA92\|FPP3_ARATH Filament-like plant protein 3	36.500%	Swiss-Prot	Medium
`Q9CAP9`	Arabidopsis thaliana	sp\|Q9CAP9\|FPP1_ARATH Filament-like plant protein 1	50.400%	Swiss-Prot	Medium
`Q9SFF4`	Arabidopsis thaliana	sp\|Q9SFF4\|FPP2_ARATH Filament-like plant protein 2	32.000%	Swiss-Prot	Medium
`Q0WSY2`	Arabidopsis thaliana	sp\|Q0WSY2\|FPP4_ARATH Filament-like plant protein 4	39.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card