TkA07G400060 | RubberDandelionOmics

Gene overview

TkA07G400060

Reference: TK1151 Chr: Chr07 Coordinates: 100523033-100526361 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1040 bp · TkA07G400060|TK1151|cDNA

TTTGATGAAATTAGGCCTGCATCGAGTATGGCTTCTTTTACCTAATCAATCACGGGATATCGGAAGAACTTTTACAAACCGTGTTCGACGAAAGTAAAAAATTCTTTTCGCTTCCACTCGAAGAGAAATTGAAGTTATCTCGCAAGGGCGACGTGGGTTTCGCACCAATTTATGCAGAAAACCTTGATTCGTCTTCTACTTCTAAAGGTGAAGAAAGTCGTCTAAATCTATGGCCTTCGAAAGATATTACCTTCTTGGAG...

CDS

Download CDS FASTA

732 bp · TkA07G400060|TK1151|CDS

ATGCAGAAAACCTTGATTCGTCTTCTACTTCTAAAGGTACTGCTACATCCTTCGATTCAATATTTAATCAAAGTTCAATTCTTGTATAATTTAATTACAGGGGATTTGAAAGAAACTTTCCATATCGGTCCTTTAGAAGGTGAAGAAAGTCGTCTAAATCTATGGCCTTCGAAAGAGATATTACCTTCTTGGAGAATGTTAATGGAGAAATACTACAAAAAAGTTTTGTGTGCTGGAAAAGAGTTGAGCTCTTTAATTGC...

Protein

Download Protein FASTA

243 aa · TkA07G400060|TK1151|PROTEIN

MQKTLIRLLLLKVLLHPSIQYLIKVQFLYNLITGDLKETFHIGPLEGEESRLNLWPSKEILPSWRMLMEKYYKKVLCAGKELSSLIALALNLDDDYFEKIGASDNPFGFLRLLHYPGESEIAVSDSEVVYGASAHSDYGMITLLATDGVPGLQVCKDKYKQPRTWENVSHVKGTFIVNVGDMMERWTNCLFRSTLHRVMPTGKDRYSIAFFFDPNQDCIVECLKSCCSESNPPRFCVQVSAYS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G400060`
TK1151 ID	TkA07G400060
OH-1004 ID	LXL04_030370
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	83.000
Protein coverage (%)	TK1151 83.128 / OH-1004 68.466 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G400060`
Location	Chr07:100523033-100526361 (-)
Description	Similar to hxnY: 2-oxoglutarate-Fe(II) type oxidoreductase hxnY (Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030370` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0044283 small molecule biosynthetic process Biological Process GO:1900602 endocrocin biosynthetic process Biological Process GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function GO:0046872 metal ion binding Molecular Function GO:0051213 dioxygenase activity Molecular Function
KEGG gene cross-reference	afm:AFUA_4G00230 ddi:DDB_G0283291 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.670

Rank 1 · TkA07G400060 · TK1151

Nucleus0.320

Rank 2 · TkA07G400060 · TK1151

Peroxisome0.087

Rank 3 · TkA07G400060 · TK1151

Mitochondrion0.065

Rank 4 · TkA07G400060 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkA07G400060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF031712OG-FeII_Oxy34-53 aa

PF031712OG-FeII_Oxy110-214 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G400060	`PF03171`	2OG-FeII_Oxy	34	53	6.9e-23	81.6
TkA07G400060	`PF03171`	2OG-FeII_Oxy	110	214	6.9e-23	81.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card