TkA07G398950 | RubberDandelionOmics

Gene overview

TkA07G398950

Reference: TK1151 Chr: Chr07 Coordinates: 100236039-100238928 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2676 bp · TkA07G398950|TK1151|cDNA

CAAAAATTGATCATCGTTCTCATCGGTATTGTTTTTCATAGTGATTTCTGAAATCATTAATTTATCGGAGTTAATCAAGTTATTGTGGTCAATATCCAGAGATATTTTCATCAATCCTCTTCCGGGGATTTCCTGGGCAGTATATAACCATCTGATTATTCCATATGATCCTTTGAATTCATTGGCGAAGGGTTGCGAATTGCAATAATATGTTTTTATGGCATCATGAATGTATGATGATGTCATCGGATTGATGAAGA...

CDS

Download CDS FASTA

2220 bp · TkA07G398950|TK1151|CDS

ATGGATGAAGTGAAAGCTCTAGAAGAAACTACAAATACAAATGGTGAAACGTCGTGTAATTTGGTCACAAATGGAGAATTAGAAAATCAAAAAGAAGATGCATCAAAAGGACCTGAAATTGAAGAAGATGATAGGTTAATACCTACACAAGAACCCGTAATTCAAAATACGGAAGAAAATAAACCAAATAATCAAATTCAACATGAAATTTCATCAGAAACGTTAGAACCAGAAGCAAATCCAGAATCGCCATCTGGAAT...

Protein

Download Protein FASTA

739 aa · TkA07G398950|TK1151|PROTEIN

MDEVKALEETTNTNGETSCNLVTNGELENQKEDASKGPEIEEDDRLIPTQEPVIQNTEENKPNNQIQHEISSETLEPEANPESPSGMTNGEISNNEEASKDVSPLEKVGPEKQLQKTKSNAIIDTTAPFESVKAAVSMFGGMDWKAHKIQAAERRKYIIQELIKARDEIPLFKKKSEKAEEMKLFVLKELDETKRLIEELKLNLEKTQTEERQAKQDAELAKLRVEEMEQGINEAASVAAKIQMEVAHARHQAAVSELET...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G398950`
TK1151 ID	TkA07G398950
OH-1004 ID	LXL04_030345
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 85.532 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G398950

Location Chr07:100236039-100238928 (+)

Description Similar to WEB1: Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33390`	Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT-like 1.	No verified direct reference in this release
`At1g45545`	Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT-like 2.	No verified direct reference in this release
`At2g26570`	Required for the chloroplast avoidance response under high intensity blue light.	Two interacting coiled-coil proteins, WEB1 and PMI2, maintain the chloroplast photorelocation movement velocity in Arabidopsis.2010 · DOI: 10.1073/pnas.1007836107
`At5g42880`	Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT-like 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030345 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009903 chloroplast avoidance movement Biological Process

GO:0009904 chloroplast accumulation movement Biological Process

GO:0071260 cellular response to mechanical stimulus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT1G45545

ath:AT2G26570

ath:AT4G33390

ath:AT5G42880

ath:AT5G55860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.471

Rank 1 · TkA07G398950 · TK1151

Cell membrane0.398

Rank 2 · TkA07G398950 · TK1151

Nucleus0.247

Rank 3 · TkA07G398950 · TK1151

Plastid0.047

Rank 4 · TkA07G398950 · TK1151

Endoplasmic reticulum0.046

Rank 5 · TkA07G398950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05701WEMBL121-676 aa

PF00660SRP1_TIP1246-277 aa

PF00660SRP1_TIP1367-412 aa

PF00660SRP1_TIP1589-623 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G398950	`PF05701`	WEMBL	121	676	2.4e-210	700.8
TkA07G398950	`PF00660`	SRP1_TIP1	246	277	1.8	9.4
TkA07G398950	`PF00660`	SRP1_TIP1	367	412	1.8	9.4
TkA07G398950	`PF00660`	SRP1_TIP1	589	623	1.8	9.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZB6`	Arabidopsis thaliana	sp\|Q9SZB6\|WEL1_ARATH Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT-like 1	44.900%	Swiss-Prot	Medium
`Q9C638`	Arabidopsis thaliana	sp\|Q9C638\|WEL2_ARATH Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT-like 2	44.200%	Swiss-Prot	Low
`O48724`	Arabidopsis thaliana	sp\|O48724\|WEB1_ARATH Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT 1	46.700%	Swiss-Prot	Low
`Q9FMN1`	Arabidopsis thaliana	sp\|Q9FMN1\|WEL3_ARATH Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT-like 3	40.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card