TkA07G398120 | RubberDandelionOmics

Gene overview

TkA07G398120

Reference: TK1151 Chr: Chr07 Coordinates: 100026369-100028676 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1821 bp · TkA07G398120|TK1151|cDNA

AAAGAAGAGAATAAAGCTGAAACTTGAACAGAAAAGGTGGAATTCTGTGAAAAGAAGAGAATAAACCTGAAACTCTATGAAAAGGACATGTACTGCATACAAAAGCAGAAACACATAGGATGATCATGAGCCAAGTTTCACAGGGGCAAGGAAACCGTGCTTTTTAACTTTATATAGAACACCCTCAATTACCATCAAACACAAAAACTCTTCTCTTTCGCACAGAGCACATCGCCACACACTGCAATAGCTCCGACTTC...

CDS

Download CDS FASTA

1221 bp · TkA07G398120|TK1151|CDS

ATGGAAGGCTTACCTGCTGAATTCGTGGTCAATATTCTGTCAAGACTTGCGGTGAAGAAAATCATCCACTGCAAGTGCGTATGCAAAAAATGGCTGGGTCTGATTTCACACTCTTACTTTGACAATCTTCGTCTCTCGAGATCACCTCCAACCCTCCTGATTCATCATAATTCAGTAGGATACGATAGGAATAGCAACCAACCTGGCATATTAACATGGGTGGAGGTTGAAGACGATCTCGATCATCACCATTTACACCA...

Protein

Download Protein FASTA

406 aa · TkA07G398120|TK1151|PROTEIN

MEGLPAEFVVNILSRLAVKKIIHCKCVCKKWLGLISHSYFDNLRLSRSPPTLLIHHNSVGYDRNSNQPGILTWVEVEDDLDHHHLHHDPLMNLNLNLSPIFQESSTLLLGSVDGMVYLWQEHKDNSYICNPISREYMILPPPRTYYHQKGLGPPTIIITSCFGVGSVTKKYKVIRIAQQLNPLRLSEAEVYTLGTHGQWRSPSPGNVPYWLGGGHHGTFLNGHAHWIIFDKYSSEKKIYVFDFDNEIFKLFPSPPIGDIE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G398120`
TK1151 ID	TkA07G398120
OH-1004 ID	LXL04_030334
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 88.865 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G398120

Location Chr07:100026369-100028676 (-)

Description Similar to At3g07870: F-box protein At3g07870

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07870`	F-box protein At3g07870.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030334 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G33020

ath:AT3G06240

ath:AT3G07870

ath:AT3G16210

ath:AT3G23880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.634

Rank 1 · TkA07G398120 · TK1151

Nucleus0.394

Rank 2 · TkA07G398120 · TK1151

Cell membrane0.124

Rank 3 · TkA07G398120 · TK1151

Endoplasmic reticulum0.070

Rank 4 · TkA07G398120 · TK1151

Lysosome / Vacuole0.049

Rank 5 · TkA07G398120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like2-38 aa

PF00646F-box3-40 aa

PF23381Beta-prop_IFT122_1st100-124 aa

PF24750b-prop_At3g26010-like104-246 aa

PF08268FBA_3105-307 aa

PF03478Beta-prop_KIB1-4107-294 aa

PF07734FBA_1111-314 aa

PF18672PilZN1329-362 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G398120	`PF12937`	F-box-like	2	38	2.9e-06	27.7
TkA07G398120	`PF00646`	F-box	3	40	1.3e-05	25.6
TkA07G398120	`PF23381`	Beta-prop_IFT122_1st	100	124	0.14	12.2
TkA07G398120	`PF24750`	b-prop_At3g26010-like	104	246	1.5e-07	31.6
TkA07G398120	`PF08268`	FBA_3	105	307	7.7e-19	68.6
TkA07G398120	`PF03478`	Beta-prop_KIB1-4	107	294	0.009	16.3
TkA07G398120	`PF07734`	FBA_1	111	314	9.5e-16	58.4
TkA07G398120	`PF18672`	PilZN1	329	362	0.26	12.2
TkA07G398120	`PF23381`	Beta-prop_IFT122_1st	346	389	0.14	12.2
TkA07G398120	`PF24750`	b-prop_At3g26010-like	361	375	1.5e-07	31.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFC7`	Arabidopsis thaliana	sp\|Q9SFC7\|FB135_ARATH F-box protein At3g07870	26.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card