TkA07G397590 | RubberDandelionOmics

Gene overview

TkA07G397590

Reference: TK1151 Chr: Chr07 Coordinates: 99910445-99914176 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3074 bp · TkA07G397590|TK1151|cDNA

TGCGATATAAATCTGTACCGCCGCCATCGCCTGTCACCCACTGTCGACAAGGCAAGGTTGAATTTGGTGATAATTGTATTCAAGAATCTCGCGCATAGTCAGTCCATGGCTCACAATCAGGTTGAGCATTTTGCTCAACGGAAACATTTTCCTGCGTATTGGTCCATGGAAGCTGTGACTGTTGCATTAGAGAAAGGCGATGTGTTCAAAACAATGTTTCGAGTGAATGCACATAATCGGGTTGAGGCCTATTGCAAAAT...

CDS

Download CDS FASTA

2769 bp · TkA07G397590|TK1151|CDS

TGCGATATAAATCTGTACCGCCGCCATCGCCTGTCACCCACTGTCGACAAGGCAAGGTTGAATTTGGTGATAATTGTATTCAAGAATCTCGCGCATAGTCAGTCCATGGCTCACAATCAGGTTGAGCATTTTGCTCAACGGAAACATTTTCCTGCGTATTGGTCCATGGAAGCTGTGACTGTTGCATTAGAGAAAGGCGATGTGTTCAAAACAATGTTTCGAGTGAATGCACATAATCGGGTTGAGGCCTATTGCAAAAT...

Protein

Download Protein FASTA

922 aa · TkA07G397590|TK1151|PROTEIN

CDINLYRRHRLSPTVDKARLNLVIIVFKNLAHSQSMAHNQVEHFAQRKHFPAYWSMEAVTVALEKGDVFKTMFRVNAHNRVEAYCKIDGLPIDVLISGFYSQNRAVEGDIVAIKVDPFSSWTKMKGSVEASPEKLLHNTNGTFHGQDLRPANFEQDHTTASSANEGREAATLVEKLSSLITSFPSKRPTGRVVAIIETSPRRNTIVGFLRIKNYLIKKTKLPFPSSSPPKHDHIQLMPTDPKFPKMIVPVKTLPTTITKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G397590`
TK1151 ID	TkA07G397590
OH-1004 ID	LXL04_030330
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.000
Protein coverage (%)	TK1151 97.180 / OH-1004 93.595 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G397590

Location Chr07:99910445-99914176 (-)

Description Similar to SOV: DIS3-like exonuclease 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P0DM58`	3'-5'-exoribonuclease that specifically recognizes RNAs polyuridylated at their 3' end and mediates their degradation.	No verified direct reference in this release
`At1g77680`	Probable inactive 3'-5'-exoribonuclease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030330 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0000956 nuclear-transcribed mRNA catabolic process Biological Process

GO:0006402 mRNA catabolic process Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0010587 miRNA catabolic process Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0051301 cell division Biological Process

GO:0051306 mitotic sister chromatid separation Biological Process

GO:1990074 polyuridylation-dependent mRNA catabolic process Biological Process

GO:0000932 P-body Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G77680

hsa:129563

mmu:208718

xtr:780265

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.573

Rank 1 · TkA07G397590 · TK1151

Nucleus0.340

Rank 2 · TkA07G397590 · TK1151

Mitochondrion0.109

Rank 3 · TkA07G397590 · TK1151

Plastid0.059

Rank 4 · TkA07G397590 · TK1151

Peroxisome0.053

Rank 5 · TkA07G397590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17216Rrp44_CSD150-167 aa

PF17876CSD2102-128 aa

PF17876CSD2180-197 aa

PF17849OB_Dis3235-312 aa

PF17876CSD2270-311 aa

PF00773RNB343-691 aa

PF17877Dis3l2_C_term779-845 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G397590	`PF17216`	Rrp44_CSD1	50	167	9e-06	26.2
TkA07G397590	`PF17876`	CSD2	102	128	0.00053	20.7
TkA07G397590	`PF17876`	CSD2	180	197	0.00053	20.7
TkA07G397590	`PF17849`	OB_Dis3	235	312	5.3e-16	59.1
TkA07G397590	`PF17876`	CSD2	270	311	0.00053	20.7
TkA07G397590	`PF00773`	RNB	343	691	6.5e-102	341.8
TkA07G397590	`PF17877`	Dis3l2_C_term	779	845	0.00057	20.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DM58`	Arabidopsis thaliana	sp\|P0DM58\|DI3L2_ARATH DIS3-like exonuclease 2	51.100%	Swiss-Prot	High
`Q0WPN0`	Arabidopsis thaliana	sp\|Q0WPN0\|DI32L_ARATH Inactive exonuclease DIS3L2	51.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card