LXL04_030330 | RubberDandelionOmics

Gene overview

LXL04_030330

Reference: OH-1004 Chr: Chr06 Coordinates: 114370894-114374808 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2907 bp · LXL04_030330|LXL04_030330|OH1004|cDNA

atggacccctttgttaggtttagtttggagaaataTTTCTTTGATTTCAggatagtgtgtgtggtaccacaatctgctattaaaagatctccaagatttctttgctgttgtgctccagttggactcatgttaagcttgcttaatgactttgcttttagagctttcgtgctgataacgtgttatgaatatgaaAATCTCGCGCATAGTCAGTCCATGGCTCACAATCAGGTTGAGCATTTTGCTCAACGGAAACATTTTCC...

CDS

Download CDS FASTA

2907 bp · LXL04_030330|LXL04_030330|OH1004|CDS

ATGGACCCCTTTGTTAGGTTTAGTTTGGAGAAATATTTCTTTGATTTCAGGATAGTGTGTGTGGTACCACAATCTGCTATTAAAAGATCTCCAAGATTTCTTTGCTGTTGTGCTCCAGTTGGACTCATGTTAAGCTTGCTTAATGACTTTGCTTTTAGAGCTTTCGTGCTGATAACGTGTTATGAATATGAAAATCTCGCGCATAGTCAGTCCATGGCTCACAATCAGGTTGAGCATTTTGCTCAACGGAAACATTTTCC...

Protein

Download Protein FASTA

968 aa · LXL04_030330|LXL04_030330|OH1004|PROTEIN

MDPFVRFSLEKYFFDFRIVCVVPQSAIKRSPRFLCCCAPVGLMLSLLNDFAFRAFVLITCYEYENLAHSQSMAHNQVEHFAQRKHFPAYWSMEAVTVALEKGDVFKTMFRVNAHNRVEAYCKIDGLPIDVLISGFYSQNRAVEGDIVAIKVDPFSSWTKMKGSVEASPEKLLHNTNGTFHGQDLRPANFEQDHTTASSANEGREAATLVEKLSSLITSFPSKRPTGRVVAIIETSPRRNTIVGFLRIKNYLIKKTKLPFP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030330`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030330

Location Chr06:114370894-114374808 (-)

Description Similar to SOV: DIS3-like exonuclease 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P0DM58`	3'-5'-exoribonuclease that specifically recognizes RNAs polyuridylated at their 3' end and mediates their degradation.	No verified direct reference in this release
`At1g77680`	Probable inactive 3'-5'-exoribonuclease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030330 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0000956 nuclear-transcribed mRNA catabolic process Biological Process

GO:0006402 mRNA catabolic process Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0010587 miRNA catabolic process Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0051301 cell division Biological Process

GO:0051306 mitotic sister chromatid separation Biological Process

GO:1990074 polyuridylation-dependent mRNA catabolic process Biological Process

GO:0000932 P-body Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G77680

hsa:129563

mmu:208718

xtr:780265

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.547

Rank 1 · LXL04_030330 · OH-1004

Nucleus0.333

Rank 2 · LXL04_030330 · OH-1004

Mitochondrion0.122

Rank 3 · LXL04_030330 · OH-1004

Plastid0.063

Rank 4 · LXL04_030330 · OH-1004

Peroxisome0.062

Rank 5 · LXL04_030330 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17216.10Rrp44_CSD186-203 aa

PF17849.8OB_Dis3271-348 aa

PF00773.26RNB379-727 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030330	`PF17216.10`	Rrp44_CSD1	86	203	9e-06	26.2
LXL04_030330	`PF17849.8`	OB_Dis3	271	348	6.7e-16	58.8
LXL04_030330	`PF00773.26`	RNB	379	727	3.3e-103	346.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DM58`	Arabidopsis thaliana	DIS3-like exonuclease 2	50.901%	Swiss-Prot	strong database homology
`Q0WPN0`	Arabidopsis thaliana	Inactive exonuclease DIS3L2	50.795%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card