RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G397350
Reference: TK1151 Chr: Chr07 Coordinates: 99810771-99815055 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3290 bp · TkA07G397350|TK1151|cDNA

TTATGAGATATAGTTTGTGAGATTAATGCCAAAAAATACTAGTGGTAATAGCATAAACGACGAGGCAAAGCACATCCTCAACGTTTTCCAATGCAAGATGTAATATGCAACGCCGGATCACGACTATTCTCTTTGCTTTTCCCCCCTCTCTCTCTCTCTCTCCTACACCCTACTCTTTACTTTTCAGTTTCAGAGTTTCGTCTCTTTACTCTCTCTCACCACTGTTCCTCCCTACCCCAGTATTCCGTTTGTTCGATTAT...

CDS

Download CDS FASTA

2382 bp · TkA07G397350|TK1151|CDS

ATGCCGGAACCATTGGTATCTTCGTCTCCTTCGTCCAATGAAGATAATGACAATACTTTTGCAACAAAGAAGAAGAAATCGGAAGAAGAGACGGAACCCAAACCGTTAGTTGCTGTAGGTAGAAGTAGATCTCAGGCTGCTGCCCGTCGTGTGGCTCCGACGTCCACCGGTGCGGTAGCTGTTTCTGTTCCTGAAGCCGTGGCTACGACATCTGGTTCGGCGACTACTGAGAAACATCTCCAGAACGGGGATCTCTACAT...

Protein

Download Protein FASTA

793 aa · TkA07G397350|TK1151|PROTEIN

MPEPLVSSSPSSNEDNDNTFATKKKKSEEETEPKPLVAVGRSRSQAAARRVAPTSTGAVAVSVPEAVATTSGSATTEKHLQNGDLYIGSFSGNVPHGSGKYLWSDGCMYEGDWKRGKASGKGKFSWPSGATYEGEFKSGRMEGSGTFTGSDGDTYRGSWSSDRKHGYGQKRYSNGDYYEGTWRRNLQDGQGRYVWKNGNEYVGDWRNGVINGRGILIWANGNRYDGNWENGVPKGHGVFTWPDGGCYVGCWSKESNFNFK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G397350
TK1151 IDTkA07G397350
OH-1004 IDLXL04_030320
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G397350
LocationChr07:99810771-99815055 (-)
DescriptionSimilar to PIP5K1: Phosphatidylinositol 4-phosphate 5-kinase 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g21980 Catalyzes the synthesis of phosphatidylinositol 4,5- bisphosphate and phosphatidylinositol 3,4-bisphosphate.
AtPIP5K1, an Arabidopsis thaliana phosphatidylinositol phosphate kinase, synthesizes PtdIns(3,4)P(2) and PtdIns(4,5)P(2) in vitro and is inhibited by phosphorylation.2001 · DOI: 10.1042/0264-6021:3590583
At1g77740 Possesses phosphatidylinositol (PtdIns) phosphate kinase activity (Probable).
Arabidopsis Rab-E GTPases exhibit a novel interaction with a plasma-membrane phosphatidylinositol-4-phosphate 5-kinase.2009 · DOI: 10.1242/jcs.053488
At2g26420 With DRP1A and DRP2B, required for the precise coordination of polar ARAC3/ROP6 and ARAC4/ROP2 placement and subsequent root hair positioning during planar polarity formation in root hair-forming cells, probably by mediating the correct basal-to-planar polarity switching of D6PK into the polar, lipid-enriched domain.
Arabidopsis D6PK is a lipid domain-dependent mediator of root epidermal planar polarity.2015 · DOI: 10.1038/nplants.2015.162
At3g56960 Phosphatidylinositol 4-phosphate 5-kinase 4. No verified direct reference in this release
At3g07960 Phosphatidylinositol 4-phosphate 5-kinase 6. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_030320 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0003006 developmental process involved in reproduction Biological Process
GO:0006897 endocytosis Biological Process
GO:0007164 establishment of tissue polarity Biological Process
GO:0009827 plant-type cell wall modification Biological Process
GO:0009846 pollen germination Biological Process
GO:0009860 pollen tube growth Biological Process
GO:0009958 positive gravitropism Biological Process
GO:0010118 stomatal movement Biological Process
GO:0010311 lateral root formation Biological Process
GO:0046488 phosphatidylinositol metabolic process Biological Process
GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process
GO:0048766 root hair initiation Biological Process
KEGG gene cross-reference
ath:AT1G21980
ath:AT1G77740
ath:AT2G26420
ath:AT3G07960
ath:AT3G56960
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.532
Rank 1 · TkA07G397350 · TK1151
Cytoplasm0.275
Rank 2 · TkA07G397350 · TK1151
Nucleus0.220
Rank 3 · TkA07G397350 · TK1151
Plastid0.057
Rank 4 · TkA07G397350 · TK1151
Endoplasmic reticulum0.051
Rank 5 · TkA07G397350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02493MORN86-108 aa
PF17479DUF3048_C97-130 aa
PF02493MORN109-130 aa
PF02493MORN132-154 aa
PF17479DUF3048_C143-164 aa
PF02493MORN155-176 aa
PF17479DUF3048_C173-200 aa
PF02493MORN178-199 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G397350PF02493MORN861086.2e-46152.2
TkA07G397350PF17479DUF3048_C971300.1912.8
TkA07G397350PF02493MORN1091306.2e-46152.2
TkA07G397350PF02493MORN1321546.2e-46152.2
TkA07G397350PF17479DUF3048_C1431640.1912.8
TkA07G397350PF02493MORN1551766.2e-46152.2
TkA07G397350PF17479DUF3048_C1732000.1912.8
TkA07G397350PF02493MORN1781996.2e-46152.2
TkA07G397350PF02493MORN2012236.2e-46152.2
TkA07G397350PF17479DUF3048_C2112440.1912.8
TkA07G397350PF02493MORN2242456.2e-46152.2
TkA07G397350PF01504PIP5K4767871.1e-103347.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q56YP2Arabidopsis thalianasp|Q56YP2|PI5K1_ARATH Phosphatidylinositol 4-phosphate 5-kinase 181.900%Swiss-ProtMedium
Q8L796Arabidopsis thalianasp|Q8L796|PI5K2_ARATH Phosphatidylinositol 4-phosphate 5-kinase 280.700%Swiss-ProtMedium
O48709Arabidopsis thalianasp|O48709|PI5K3_ARATH Phosphatidylinositol 4-phosphate 5-kinase 357.400%Swiss-ProtMedium
Q9M1K2Arabidopsis thalianasp|Q9M1K2|PI5K4_ARATH Phosphatidylinositol 4-phosphate 5-kinase 459.400%Swiss-ProtMedium
Q9SFB8Arabidopsis thalianasp|Q9SFB8|PI5K6_ARATH Phosphatidylinositol 4-phosphate 5-kinase 658.600%Swiss-ProtMedium

JBrowse

View in Genome Browser