TkA07G396250 | RubberDandelionOmics

Gene overview

TkA07G396250

Reference: TK1151 Chr: Chr07 Coordinates: 99536428-99537027 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

555 bp · TkA07G396250|TK1151|cDNA

ATGAAGAGATCAATATCTAAATCCGAAGATCCTATCAACGGCACCGTTGATGTTAACAATAGCAAGACGAAGAAGATCAAATTATCGGAAGATCAGGCTCCGGTGACCGACTCAGTTCCGGAGGAGACGTCTGCGTCTGTTCTTTCGGACGAAAACTTGCTCTACGAGGTTCTGAAGCACGTCGATGCGCGGACGTTAGGTGCGGCGGGTTGCGTGAGCAAGCAGTGGCATCGGACTTCTCAGGATGAGCGGCTATGGGA...

CDS

Download CDS FASTA

555 bp · TkA07G396250|TK1151|CDS

ATGAAGAGATCAATATCTAAATCCGAAGATCCTATCAACGGCACCGTTGATGTTAACAATAGCAAGACGAAGAAGATCAAATTATCGGAAGATCAGGCTCCGGTGACCGACTCAGTTCCGGAGGAGACGTCTGCGTCTGTTCTTTCGGACGAAAACTTGCTCTACGAGGTTCTGAAGCACGTCGATGCGCGGACGTTAGGTGCGGCGGGTTGCGTGAGCAAGCAGTGGCATCGGACTTCTCAGGATGAGCGGCTATGGGA...

Protein

Download Protein FASTA

184 aa · TkA07G396250|TK1151|PROTEIN

MKRSISKSEDPINGTVDVNNSKTKKIKLSEDQAPVTDSVPEETSASVLSDENLLYEVLKHVDARTLGAAGCVSKQWHRTSQDERLWELICTKHWTNMGCGNNQLRSVVLALGGFRRLHAHYLWPLSKPPTSTITSSSSSTIAAVTSSSSPTSPKTHWGKDEVQLSISLLSIRYYEKMNYKNRTK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G396250`
TK1151 ID	TkA07G396250
OH-1004 ID	LXL04_030308
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G396250

Location Chr07:99536428-99537027 (+)

Description Similar to GID2: F-box protein GID2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24210`	Essential component of the SCF-type E3 ligase complex, SCF(GID2), a complex that positively regulates the gibberellin signaling pathway.	No verified direct reference in this release
`At5g48170`	Essential component of a SCF-type E3 ligase complex that positively regulates the gibberellin signaling pathway.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0580300`	Essential component of some SCF-type E3 ligase complex that positively regulates the gibberellin signaling pathway.	Accumulation of phosphorylated repressor for gibberellin signaling in an F-box mutant.2003 · DOI: 10.1126/science.1081077 GID2, an F-box subunit of the SCF E3 complex, specifically interacts with phosphorylated SLR1 protein and regulates the gibberellin-dependent degradation of SLR1 in rice.2004 · DOI: 10.1111/j.1365-313x.2003.01990.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030308 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0009937 regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0009939 positive regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010162 seed dormancy process Biological Process

GO:0010265 SCF complex assembly Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0048831 regulation of shoot system development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT4G24210

ath:AT5G48170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · TkA07G396250 · TK1151

Cytoplasm0.111

Rank 2 · TkA07G396250 · TK1151

Cell membrane0.040

Rank 3 · TkA07G396250 · TK1151

Endoplasmic reticulum0.032

Rank 4 · TkA07G396250 · TK1151

Plastid0.018

Rank 5 · TkA07G396250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box52-87 aa

PF12937F-box-like53-91 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G396250	`PF00646`	F-box	52	87	4.6e-06	27.0
TkA07G396250	`PF12937`	F-box-like	53	91	4.4e-07	30.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STX3`	Arabidopsis thaliana	sp\|Q9STX3\|GID2_ARATH F-box protein GID2	54.400%	Swiss-Prot	High
`Q9LUB6`	Arabidopsis thaliana	sp\|Q9LUB6\|SNE_ARATH F-box protein SNE	28.000%	Swiss-Prot	Low
`Q7XAK4`	Oryza sativa subsp. japonica	sp\|Q7XAK4\|GID2_ORYSJ F-box protein GID2	43.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card