TkA07G395540 | RubberDandelionOmics

Gene overview

TkA07G395540

Reference: TK1151 Chr: Chr07 Coordinates: 99336789-99338066 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1134 bp · TkA07G395540|TK1151|cDNA

ACATCTTTTATCCAACTCAAACTACAATACGATCTTTCTTTACTTTCTCTCCAAAGAATGCCGATCCCTGTGATTGACTTCTCAAAGCTCAATGGCCAAGCGCGAGCCACAACAATGAATCAGATAGCAAACGGATGTGAAGAATGGGGTTTCTTTCAGTTGGTGAATCATGGGATTCCGGTGGAGCTTCTTGAGAGAGTGAAAAAGGTAAGCTCCGATTGCTATAAGTTACAGAGGGAAGAAAACTTTTTCAGCAATTC...

CDS

Download CDS FASTA

939 bp · TkA07G395540|TK1151|CDS

ATGCCGATCCCTGTGATTGACTTCTCAAAGCTCAATGGCCAAGCGCGAGCCACAACAATGAATCAGATAGCAAACGGATGTGAAGAATGGGGTTTCTTTCAGTTGGTGAATCATGGGATTCCGGTGGAGCTTCTTGAGAGAGTGAAAAAGGTAAGCTCCGATTGCTATAAGTTACAGAGGGAAGAAAACTTTTTCAGCAATTCAACACCCAGAAAACGGTTAGAGGAATTAGTCGAAAAGAAGAGTGGAGACAAGCTGGA...

Protein

Download Protein FASTA

312 aa · TkA07G395540|TK1151|PROTEIN

MPIPVIDFSKLNGQARATTMNQIANGCEEWGFFQLVNHGIPVELLERVKKVSSDCYKLQREENFFSNSTPRKRLEELVEKKSGDKLENVDWEDVFLLTDNNEWPSETPGFKETMMEYRAKVKQLAEKLMEIMDENLGLPKGYIKKAFNGGEEETAFFGTKVSHYPPCPHPEMVNGLRAHTDAGGVVLLFQDDQVEGLEILKDGNWIDVQPIPNSIVINTGDQIEVLSNGRYKSVWHRVQAMPDRTRRSIASFYNPSYKAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G395540`
TK1151 ID	TkA07G395540
OH-1004 ID	LXL04_030294
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.500
Protein coverage (%)	TK1151 98.718 / OH-1004 97.161 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G395540

Location Chr07:99336789-99338066 (+)

Description Similar to At1g77330: 1-aminocyclopropane-1-carboxylate oxidase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g77330`	Enzyme involved in the ethylene biosynthesis.	No verified direct reference in this release
`At1g05010`	Enzyme involved in the ethylene biosynthesis.	No verified direct reference in this release
`At1g62380`	Enzyme involved in the ethylene biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030294 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009693 ethylene biosynthetic process Biological Process

GO:0009835 fruit ripening Biological Process

GO:0071398 cellular response to fatty acid Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009815 1-aminocyclopropane-1-carboxylate oxidase activity Molecular Function

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

GO:0031418 L-ascorbic acid binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G77330

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.781

Rank 1 · TkA07G395540 · TK1151

Nucleus0.315

Rank 2 · TkA07G395540 · TK1151

Mitochondrion0.062

Rank 3 · TkA07G395540 · TK1151

Peroxisome0.062

Rank 4 · TkA07G395540 · TK1151

Endoplasmic reticulum0.046

Rank 5 · TkA07G395540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226DIOX_N3-101 aa

PF05742TANGO213-104 aa

PF22339YgxA-like_sub_bind20-78 aa

PF18305DNA_pol_A_exoN99-139 aa

PF031712OG-FeII_Oxy161-255 aa

PF05742TANGO2219-273 aa

PF22339YgxA-like_sub_bind222-241 aa

PF14226DIOX_N233-270 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G395540	`PF14226`	DIOX_N	3	101	9.2e-19	68.9
TkA07G395540	`PF05742`	TANGO2	13	104	0.06	14.2
TkA07G395540	`PF22339`	YgxA-like_sub_bind	20	78	0.18	13.0
TkA07G395540	`PF18305`	DNA_pol_A_exoN	99	139	0.13	13.4
TkA07G395540	`PF03171`	2OG-FeII_Oxy	161	255	8.8e-32	110.2
TkA07G395540	`PF05742`	TANGO2	219	273	0.06	14.2
TkA07G395540	`PF22339`	YgxA-like_sub_bind	222	241	0.18	13.0
TkA07G395540	`PF14226`	DIOX_N	233	270	9.2e-19	68.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WPW4`	Arabidopsis thaliana	sp\|Q0WPW4\|ACCO5_ARATH 1-aminocyclopropane-1-carboxylate oxidase 5	72.300%	Swiss-Prot	High
`Q06588`	Arabidopsis thaliana	sp\|Q06588\|ACCO4_ARATH 1-aminocyclopropane-1-carboxylate oxidase 4	50.600%	Swiss-Prot	High
`Q41931`	Arabidopsis thaliana	sp\|Q41931\|ACCO2_ARATH 1-aminocyclopropane-1-carboxylate oxidase 2	49.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card