TkA07G391780 | RubberDandelionOmics

Gene overview

TkA07G391780

Reference: TK1151 Chr: Chr07 Coordinates: 98314944-98317156 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1898 bp · TkA07G391780|TK1151|cDNA

GTTAATTAAAAAAATAGTTTTAGTTTATTAGGGCGTTGCATGATGTCAATGTAGGTGAGTGTCATACCTATGAACACACCACCCCTTTGCATGATGTTCGATCTTCTCCTCTACATAACTTTTCATATCCGCAACCTGTGATCATACTTTATCCTATTTCCGAGTCCAATTTAACAAGAGAGATGAAGAAAAGGTGGATGGAAATTAGAAGAAATTAGGAAATAGTTGGTGTTTTTAAGTGAAAAAAAGTTGGAAAAATG...

CDS

Download CDS FASTA

1194 bp · TkA07G391780|TK1151|CDS

ATGGGAAGGAAGTCGGGAGGTTGGTTCACGCACTTTAAAGATCACACAAAGCTCCACAAATCGCAGGTAAACCTCCCTTTTGATTTTAAATTCCACATTCAGCCGTTTCAGTTTCTTAATCAATGCTCTAGCTTTTCATATAGTATTTTTATAACTGATCGAATTAAAACACCATGGAGAACCCATCAATCATCAATGGCGATGAAATTGAAAACATCGCCTACCAGGTGTTTGTGTTTATGCTTCATCGATATCGCATA...

Protein

Download Protein FASTA

398 aa · TkA07G391780|TK1151|PROTEIN

MGRKSGGWFTHFKDHTKLHKSQVNLPFDFKFHIQPFQFLNQCSSFSYSIFITDRIKTPWRTHQSSMAMKLKTSPTRCLCLCFIDIAYFNCWLMRFFVAFLPHPLLIIHLLWKSKDCTMASSSITSTNIIQNHDFSNGLLSWNPNSCDGVVVEKPSNRYAVIANRKQTWQGLEQDITSRISIGSTYNLSAIVGVSGEHLHGHADVIATLKLEYHGSETKYMSIKRTSISKDTWGNLEGTFMLPDKPDRVVLYLEGPAPGVN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G391780`
TK1151 ID	TkA07G391780
OH-1004 ID	LXL04_030265
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	76.000
Protein coverage (%)	TK1151 98.241 / OH-1004 32.369 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G391780

Location Chr07:98314944-98317156 (+)

Description Similar to XYN1: Endo-1,4-beta-xylanase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g58370`	Binds to and hydrolyzes insoluble and soluble xylan substrates (By similarity).	A xylanase, AtXyn1, is predominantly expressed in vascular bundles, and four putative xylanase genes were identified in the Arabidopsis thaliana genome.2002 · DOI: 10.1093/pcp/pcf088
`At1g10050`	Binds to and hydrolyzes insoluble and soluble xylan substrates.	No verified direct reference in this release
`At4g08160`	Binds to and hydrolyzes insoluble and soluble xylan substrates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030265 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0045493 xylan catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0031176 endo-1,4-beta-xylanase activity Molecular Function

KEGG gene cross-reference

ath:AT1G10050

ath:AT1G58370

ath:AT4G08160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.259

Rank 1 · TkA07G391780 · TK1151

Nucleus0.210

Rank 2 · TkA07G391780 · TK1151

Cytoplasm0.202

Rank 3 · TkA07G391780 · TK1151

Cell membrane0.185

Rank 4 · TkA07G391780 · TK1151

Extracellular0.144

Rank 5 · TkA07G391780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02018CBM_4_9127-257 aa

PF02018CBM_4_9287-392 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G391780	`PF02018`	CBM_4_9	127	257	2.1e-38	132.5
TkA07G391780	`PF02018`	CBM_4_9	287	392	2.1e-38	132.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A1P8AWH8`	Arabidopsis thaliana	sp\|A0A1P8AWH8\|XYN1_ARATH Endo-1,4-beta-xylanase 1	54.700%	Swiss-Prot	Medium
`O80596`	Arabidopsis thaliana	sp\|O80596\|XYN2_ARATH Endo-1,4-beta-xylanase 2	39.100%	Swiss-Prot	Medium
`F4JG10`	Arabidopsis thaliana	sp\|F4JG10\|XYN3_ARATH Endo-1,4-beta-xylanase 3	60.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card