TkA07G389880 | RubberDandelionOmics

Gene overview

TkA07G389880

Reference: TK1151 Chr: Chr07 Coordinates: 97762707-97763363 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

657 bp · TkA07G389880|TK1151|cDNA

ATGGCCACTAACACTCTTCAAACATTCACGGACTTTTACGACGGCTGGCTCCTCCGCCACCTGCACCTCCAAAACCAGTTAACGGCCGTCGACAATGTCAAAGAATTAGTAGAACTCGATAAACTGGTGCTCAAAGCCTCCGATCACTACCGCCAATACTACGAAGAAAAATCAAACGCAACCGATAAAGACGTTTTCCTCATTTGCTCTCCGCCGTGGTACACTTCTTTCGAGATAGCATTATTCTGGGTGGCGGATTT...

CDS

Download CDS FASTA

657 bp · TkA07G389880|TK1151|CDS

ATGGCCACTAACACTCTTCAAACATTCACGGACTTTTACGACGGCTGGCTCCTCCGCCACCTGCACCTCCAAAACCAGTTAACGGCCGTCGACAATGTCAAAGAATTAGTAGAACTCGATAAACTGGTGCTCAAAGCCTCCGATCACTACCGCCAATACTACGAAGAAAAATCAAACGCAACCGATAAAGACGTTTTCCTCATTTGCTCTCCGCCGTGGTACACTTCTTTCGAGATAGCATTATTCTGGGTGGCGGATTT...

Protein

Download Protein FASTA

218 aa · TkA07G389880|TK1151|PROTEIN

MATNTLQTFTDFYDGWLLRHLHLQNQLTAVDNVKELVELDKLVLKASDHYRQYYEEKSNATDKDVFLICSPPWYTSFEIALFWVADFQPSSLFRFVGDLNLTTEQARWVETVKVKTARKESEIGEAMAVVQESLAAAPLYGLMNRTERLVNGQVSELDDAMEEVKEAMRVVMVEADELRVAAAVEILEVLGVVQRVKFFAAVGEFRIRARRIGLQMEV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G389880`
TK1151 ID	TkA07G389880
OH-1004 ID	LXL04_030249
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G389880

Location Chr07:97762707-97763363 (+)

Description Similar to ZW2: Protein ZW2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09950`	Negative regulator of salt (NaCl) tolerance probably by enhancing abscisic acid (ABA) sensitivity.	RAS1, a quantitative trait locus for salt tolerance and ABA sensitivity in Arabidopsis.2010 · DOI: 10.1073/pnas.0910798107

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030249 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:1900070 negative regulation of cellular hyperosmotic salinity response Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G09950

ath:AT1G58330

ath:AT4G18650

ath:AT4G18690

ath:AT5G65210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.468

Rank 1 · TkA07G389880 · TK1151

Nucleus0.368

Rank 2 · TkA07G389880 · TK1151

Plastid0.151

Rank 3 · TkA07G389880 · TK1151

Cell membrane0.074

Rank 4 · TkA07G389880 · TK1151

Endoplasmic reticulum0.066

Rank 5 · TkA07G389880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12799LRR_418-44 aa

PF09763Sec3_CC28-56 aa

PF14144DOG132-96 aa

PF09763Sec3_CC98-134 aa

PF09763Sec3_CC144-179 aa

PF14144DOG1147-168 aa

PF24220DUF7439171-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G389880	`PF12799`	LRR_4	18	44	0.24	12.4
TkA07G389880	`PF09763`	Sec3_CC	28	56	0.12	12.9
TkA07G389880	`PF14144`	DOG1	32	96	9.9e-19	68.0
TkA07G389880	`PF09763`	Sec3_CC	98	134	0.12	12.9
TkA07G389880	`PF09763`	Sec3_CC	144	179	0.12	12.9
TkA07G389880	`PF14144`	DOG1	147	168	9.9e-19	68.0
TkA07G389880	`PF24220`	DUF7439	171	195	0.001	19.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04515`	Arabidopsis thaliana	sp\|O04515\|RAS1_ARATH Protein RESPONSE TO ABA AND SALT 1	34.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card