TkA07G387500 | RubberDandelionOmics

Gene overview

TkA07G387500

Reference: TK1151 Chr: Chr07 Coordinates: 97161582-97162522 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

303 bp · TkA07G387500|TK1151|cDNA

ATGATGGGAGAAGAGCTTTCTGGTTTAAGTGTCAAAGATCTACAAGGCATGGAGAACCAACTTGAAATGAGTCTCAAAGGTATCCGCATGAAAAAGGGGAGTCTTATTCACCATGAAAACGTCGAACTGTGTACGAAAATGACCCAAATTCGTGAAGAGAACATCCAACTTTATAACAAGATTACAACTACATTAGCGAGAAAAGGGGTGAACTCCAAAGGCTATCATAGACAACTCAGAAATGACTTGATTGACGGAAT...

CDS

Download CDS FASTA

303 bp · TkA07G387500|TK1151|CDS

ATGATGGGAGAAGAGCTTTCTGGTTTAAGTGTCAAAGATCTACAAGGCATGGAGAACCAACTTGAAATGAGTCTCAAAGGTATCCGCATGAAAAAGGGGAGTCTTATTCACCATGAAAACGTCGAACTGTGTACGAAAATGACCCAAATTCGTGAAGAGAACATCCAACTTTATAACAAGATTACAACTACATTAGCGAGAAAAGGGGTGAACTCCAAAGGCTATCATAGACAACTCAGAAATGACTTGATTGACGGAAT...

Protein

Download Protein FASTA

100 aa · TkA07G387500|TK1151|PROTEIN

MMGEELSGLSVKDLQGMENQLEMSLKGIRMKKGSLIHHENVELCTKMTQIREENIQLYNKITTTLARKGVNSKGYHRQLRNDLIDGIKFSKWRGPKLPVR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G387500`
TK1151 ID	TkA07G387500
OH-1004 ID	LXL04_030211
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.700
Protein coverage (%)	TK1151 61.000 / OH-1004 31.282 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G387500

Location Chr07:97161582-97162522 (+)

Description Similar to AGL16: Agamous-like MADS-box protein AGL16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57230`	Probable transcription factor involved in the regulation of flowering time in long-day photoperiod.	MicroRNA-mediated regulation of stomatal development in Arabidopsis.2007 · DOI: 10.1105/tpc.107.050377 miR824-Regulated AGAMOUS-LIKE16 Contributes to Flowering Time Repression in Arabidopsis.2014 · DOI: 10.1105/tpc.114.124685
`At4g37940`	Probable transcription factor.	No verified direct reference in this release
`At2g22630`	Probable transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0731200`	Transcriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14.	The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14.2013 · DOI: 10.1038/ncomms2542
`Os02g0579600`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030211 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009908 flower development Biological Process

GO:0010440 stomatal lineage progression Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process

GO:0048586 regulation of long-day photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G22630

ath:AT3G57230

ath:AT4G37940

dosa:Os02g0579600

dosa:Os02g0731200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.768

Rank 1 · TkA07G387500 · TK1151

Cytoplasm0.280

Rank 2 · TkA07G387500 · TK1151

Cell membrane0.037

Rank 3 · TkA07G387500 · TK1151

Endoplasmic reticulum0.023

Rank 4 · TkA07G387500 · TK1151

Mitochondrion0.022

Rank 5 · TkA07G387500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01486K-box1-61 aa

PF09312SurA_N31-84 aa

PF13879Hmw_CFAP9733-65 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G387500	`PF01486`	K-box	1	61	6.3e-15	55.8
TkA07G387500	`PF09312`	SurA_N	31	84	0.14	13.0
TkA07G387500	`PF13879`	Hmw_CFAP97	33	65	0.046	15.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2RVQ5`	Arabidopsis thaliana	sp\|A2RVQ5\|AGL16_ARATH Agamous-like MADS-box protein AGL16	52.700%	Swiss-Prot	Medium
`Q9SZJ6`	Arabidopsis thaliana	sp\|Q9SZJ6\|AGL21_ARATH Agamous-like MADS-box protein AGL21	56.500%	Swiss-Prot	Low
`Q38840`	Arabidopsis thaliana	sp\|Q38840\|AGL17_ARATH Agamous-like MADS-box protein AGL17	56.500%	Swiss-Prot	Low
`Q6Z6W2`	Oryza sativa subsp. japonica	sp\|Q6Z6W2\|MAD57_ORYSJ MADS-box transcription factor 57	48.000%	Swiss-Prot	Medium
`Q6EP49`	Oryza sativa subsp. japonica	sp\|Q6EP49\|MAD27_ORYSJ MADS-box transcription factor 27	50.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card