TkA07G385710 | RubberDandelionOmics

Gene overview

TkA07G385710

Reference: TK1151 Chr: Chr07 Coordinates: 96689560-96690271 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

579 bp · TkA07G385710|TK1151|cDNA

ATGTCGCCATACATCCTGGAGGTCTCCGGTGGATCAGATATCATCGCCGCCATCACACGATTATGCAATAATCGGGGAACCGGTCTCTGCGTTTTGTCCGGTTCAGGAACCGTTTCCAGCGTCTCATTCCAACAACCCACCACCACCACTGCAGCCTTAACCTTACTCGGCCGCTTCGAGTTGCTATCGATCTCCGCCACCATTCTTCCGTCATACGTCGCTAACCTCGGAGGGAGATTTGCCGTAACATTATCCGGTCC...

CDS

Download CDS FASTA

579 bp · TkA07G385710|TK1151|CDS

ATGTCGCCATACATCCTGGAGGTCTCCGGTGGATCAGATATCATCGCCGCCATCACACGATTATGCAATAATCGGGGAACCGGTCTCTGCGTTTTGTCCGGTTCAGGAACCGTTTCCAGCGTCTCATTCCAACAACCCACCACCACCACTGCAGCCTTAACCTTACTCGGCCGCTTCGAGTTGCTATCGATCTCCGCCACCATTCTTCCGTCATACGTCGCTAACCTCGGAGGGAGATTTGCCGTAACATTATCCGGTCC...

Protein

Download Protein FASTA

192 aa · TkA07G385710|TK1151|PROTEIN

MSPYILEVSGGSDIIAAITRLCNNRGTGLCVLSGSGTVSSVSFQQPTTTTAALTLLGRFELLSISATILPSYVANLGGRFAVTLSGPQGGTVGGIVNGPLLAAGTVYIIAASFNNPLYHLLPMEEDDHVRISGGGSVSAAREQSPNSGGGDSGRRHAELSGTDSLSMYSCQLPSDVIWAPIPRQAQRQSPHY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G385710`
TK1151 ID	TkA07G385710
OH-1004 ID	LXL04_030188
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.900
Protein coverage (%)	TK1151 100.000 / OH-1004 74.194 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G385710

Location Chr07:96689560-96690271 (+)

Description Similar to AHL17: AT-hook motif nuclear-localized protein 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49700`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At1g14490`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At1g76500`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs) (By similarity).	The AT-hook-containing proteins SOB3/AHL29 and ESC/AHL27 are negative modulators of hypocotyl growth in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2007.03393.x Over-expression of an AT-hook gene, AHL22, delays flowering and inhibits the elongation of the hypocotyl in Arabidopsis thaliana.2009 · DOI: 10.1007/s11103-009-9507-9
`At2g35270`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At4g17800`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030188 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009908 flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0045824 negative regulation of innate immune response Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048440 carpel development Biological Process

GO:0048653 anther development Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

KEGG gene cross-reference

ath:AT1G14490

ath:AT1G76500

ath:AT2G35270

ath:AT4G14465

ath:AT5G49700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.840

Rank 1 · TkA07G385710 · TK1151

Cytoplasm0.208

Rank 2 · TkA07G385710 · TK1151

Cell membrane0.058

Rank 3 · TkA07G385710 · TK1151

Endoplasmic reticulum0.043

Rank 4 · TkA07G385710 · TK1151

Plastid0.022

Rank 5 · TkA07G385710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03479PCC1-114 aa

PF03479PCC131-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G385710	`PF03479`	PCC	1	114	2.9e-23	82.9
TkA07G385710	`PF03479`	PCC	131	141	2.9e-23	82.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTA2`	Arabidopsis thaliana	sp\|Q9LTA2\|AHL17_ARATH AT-hook motif nuclear-localized protein 17	47.400%	Swiss-Prot	Medium
`Q9M9R4`	Arabidopsis thaliana	sp\|Q9M9R4\|AHL28_ARATH AT-hook motif nuclear-localized protein 28	49.300%	Swiss-Prot	Medium
`Q9C9K7`	Arabidopsis thaliana	sp\|Q9C9K7\|AHL29_ARATH AT-hook motif nuclear-localized protein 29	42.400%	Swiss-Prot	Medium
`O82166`	Arabidopsis thaliana	sp\|O82166\|AHL21_ARATH AT-hook motif nuclear-localized protein 21	44.500%	Swiss-Prot	Medium
`O23620`	Arabidopsis thaliana	sp\|O23620\|AHL23_ARATH AT-hook motif nuclear-localized protein 23	46.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card