TkA07G384310 | RubberDandelionOmics

Gene overview

TkA07G384310

Reference: TK1151 Chr: Chr07 Coordinates: 96378753-96382256 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2338 bp · TkA07G384310|TK1151|cDNA

GGAAAAGTTGAAGTGGGGTTTTAGTGTGTTTCTGTGTGAGAGAGAAATAATCAACGATCACCAACTAACACTATTCTACCATGACTATACAACCCTCCAAAGAGACAAAAACCTTCGCCCCGGCATAAAAGCACTTCGCTTTCATCGCCCTTCTCTCTACCAACTCCTATGGCCGCCATTTACGGTCTATGCTCATCATCATCAACATCCAATTTGATACCAAAGCCACACTCATGGATCGTTTCGTATCCGCATCGAAT...

CDS

Download CDS FASTA

945 bp · TkA07G384310|TK1151|CDS

ATGGCCGCCATTTACGGTCTATGCTCATCATCATCAACATCCAATTTGATACCAAAGCCACACTCATGGATCGTTTCGTATCCGCATCGAATCGAAGAGACTTTCAAATCGGGCTTTTCAGGTGTCAGTTGCAAGAACTGGAGCACAAACGGCAACAACAACAATGTACTGACTCATTCGGTGGCGCGTGATGTATCCGTCAGCGTGTCTACCACCACCGGTGATGACATGGCTGGAAAATCTAAGTCCAAGAGGGTGTT...

Protein

Download Protein FASTA

314 aa · TkA07G384310|TK1151|PROTEIN

MAAIYGLCSSSSTSNLIPKPHSWIVSYPHRIEETFKSGFSGVSCKNWSTNGNNNNVLTHSVARDVSVSVSTTTGDDMAGKSKSKRVLEMDPQVLWERYTEWLYQHKDLGLYLDVSRVGFTDEFVQEMEPRFMKAFKAMEELEKGAIANPDEGRMVGHYWLRNPSLSPKASLKLQIENSIEAICAFADEIVGGKIKPPTASRFTQILSVGIGGSALGPQFVAEALAPDNPPLKIRFIDNTDPAGIDHQIAQLGPELASTLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G384310`
TK1151 ID	TkA07G384310
OH-1004 ID	LXL04_030176
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 93.312 / OH-1004 46.434 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G384310

Location Chr07:96378753-96382256 (+)

Description Similar to PGI1: Glucose-6-phosphate isomerase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24620`	Promotes the synthesis of starch in leaves.	Mutation of Arabidopsis plastid phosphoglucose isomerase affects leaf starch synthesis and floral initiation.2000 · DOI: 10.1104/pp.123.1.319

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030176 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005982 starch metabolic process Biological Process

GO:0006094 gluconeogenesis Biological Process

GO:0006096 glycolytic process Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0051156 glucose 6-phosphate metabolic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0004347 glucose-6-phosphate isomerase activity Molecular Function

GO:0048029 monosaccharide binding Molecular Function

KEGG gene cross-reference

ana:alr1050

ath:AT4G24620

ava:Ava_3708

cyc:PCC7424_3777

npu:Npun_F3925

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.977

Rank 1 · TkA07G384310 · TK1151

Mitochondrion0.038

Rank 2 · TkA07G384310 · TK1151

Cytoplasm0.024

Rank 3 · TkA07G384310 · TK1151

Nucleus0.018

Rank 4 · TkA07G384310 · TK1151

Peroxisome0.014

Rank 5 · TkA07G384310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00342PGI136-283 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G384310	`PF00342`	PGI	136	283	8e-20	71.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H103`	Arabidopsis thaliana	sp\|Q8H103\|G6PIP_ARATH Glucose-6-phosphate isomerase 1, chloroplastic	65.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card