TkA07G381440 | RubberDandelionOmics

Gene overview

TkA07G381440

Reference: TK1151 Chr: Chr07 Coordinates: 95612850-95614389 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

678 bp · TkA07G381440|TK1151|cDNA

TATAAATAAAGGATTTTGCCCTAAATTTCAAAATTCACATCGTTTGAAAGGGGATCGACGACGAAGATTTTCTGATACAGAATCAAGATGGCTCGTACTAAGCAAACTGCTCGTAAGTCCACCGGAGGAAAGGCTCCCAGGAAGCAACTTGCCACCAAGGCTGCCCGCAAGTCTGCCCCAACAACCGGAGGAGTGAAGAAGCCTCACAGATACAGACCCGGAACTGTTGCCCTTCGTGAAATCCGTAAGTACCAGAAAAG...

CDS

Download CDS FASTA

411 bp · TkA07G381440|TK1151|CDS

ATGGCTCGTACTAAGCAAACTGCTCGTAAGTCCACCGGAGGAAAGGCTCCCAGGAAGCAACTTGCCACCAAGGCTGCCCGCAAGTCTGCCCCAACAACCGGAGGAGTGAAGAAGCCTCACAGATACAGACCCGGAACTGTTGCCCTTCGTGAAATCCGTAAGTACCAGAAAAGTACGGAGCTTTTGATCCGGAAGCTTCCTTTCCAAAGGCTTGTTCGTGAGATTGCTCAGGACTTCAAGACGGATTTGCGATTCCAGAG...

Protein

Download Protein FASTA

136 aa · TkA07G381440|TK1151|PROTEIN

MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G381440`
TK1151 ID	TkA07G381440
OH-1004 ID	LXL04_030141
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G381440

Location Chr07:95612850-95614389 (+)

Description Similar to Histone H3.3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P59169`	Variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in active genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030141 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0031507 heterochromatin formation Biological Process

GO:0000786 nucleosome Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0030527 structural constituent of chromatin Molecular Function

GO:0031492 nucleosomal DNA binding Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

dosa:Os03g0390600

dosa:Os04g0450800

dosa:Os06g0130900

nta:107801897

nta:107801898

nta:107810536

nta:107813079

nta:107818315

osa:4333019

osa:4340006

vvi:100248958

vvi:100257369

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.965

Rank 1 · TkA07G381440 · TK1151

Cytoplasm0.074

Rank 2 · TkA07G381440 · TK1151

Extracellular0.020

Rank 3 · TkA07G381440 · TK1151

Cell membrane0.009

Rank 4 · TkA07G381440 · TK1151

Mitochondrion0.007

Rank 5 · TkA07G381440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15715PAF1-58 aa

PF02291TFIID-31kDa11-27 aa

PF15511CENP-T_C19-33 aa

PF00125Histone44-131 aa

PF21150YebU_pre-PUA_dom51-93 aa

PF14744WASH-7_mid55-130 aa

PF00808CBFD_NFYB_HMF65-128 aa

PF15511CENP-T_C69-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G381440	`PF15715`	PAF	1	58	0.00014	23.3
TkA07G381440	`PF02291`	TFIID-31kDa	11	27	0.016	16.0
TkA07G381440	`PF15511`	CENP-T_C	19	33	0.00019	22.2
TkA07G381440	`PF00125`	Histone	44	131	8.2e-39	132.6
TkA07G381440	`PF21150`	YebU_pre-PUA_dom	51	93	0.026	15.1
TkA07G381440	`PF14744`	WASH-7_mid	55	130	0.19	11.5
TkA07G381440	`PF00808`	CBFD_NFYB_HMF	65	128	0.0066	17.4
TkA07G381440	`PF15511`	CENP-T_C	69	130	0.00019	22.2
TkA07G381440	`PF15630`	CENP-S	71	130	0.00058	20.9
TkA07G381440	`PF02291`	TFIID-31kDa	84	130	0.016	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P59169`	Arabidopsis thaliana	sp\|P59169\|H33_ARATH Histone H3.3	100.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card