RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G380810
Reference: TK1151 Chr: Chr07 Coordinates: 95448149-95450313 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1518 bp · TkA07G380810|TK1151|cDNA

ATGACCGAAGAATACTATGTAGATTGTTCGACACTACGTGTTTCCTACACCAAATTCAAACTATTAAACATATCGCTAAAAGGCTACATGCGTGGATTATTACCAATTGGCTATCGTTGTTACAACCAAGATCATAGTATAACCATCGGCCGAGAACCCAAAATAAAGTTGTCCAGATTCCGTGTCTCAAGCTCAGAAAATGTGTTAACCGTAGTTGGGTGCGATGCTAGAGCCAACATGAAGACTTTTGAGGGTGAGGG...

CDS

Download CDS FASTA

1518 bp · TkA07G380810|TK1151|CDS

ATGACCGAAGAATACTATGTAGATTGTTCGACACTACGTGTTTCCTACACCAAATTCAAACTATTAAACATATCGCTAAAAGGCTACATGCGTGGATTATTACCAATTGGCTATCGTTGTTACAACCAAGATCATAGTATAACCATCGGCCGAGAACCCAAAATAAAGTTGTCCAGATTCCGTGTCTCAAGCTCAGAAAATGTGTTAACCGTAGTTGGGTGCGATGCTAGAGCCAACATGAAGACTTTTGAGGGTGAGGG...

Protein

Download Protein FASTA

505 aa · TkA07G380810|TK1151|PROTEIN

MTEEYYVDCSTLRVSYTKFKLLNISLKGYMRGLLPIGYRCYNQDHSITIGREPKIKLSRFRVSSSENVLTVVGCDARANMKTFEGEGYYTGCLSMTGCDRVTRGSCFGMGCSQVPVPPYLSRFRIHAQSNTQGKNVGNWSYNNCTYGFLVEKGHYAFRKTDVDDLKKRSFPVVLEWSVDSVKCEEAKKNASSYVCQENSVCLDTVIESNRTYQGYRCQCVEGYEGNPYLPNGCQDIDECKGAQHECKYDCINTNGSYNCS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G380810
TK1151 IDTkA07G380810
OH-1004 IDLXL04_030135
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)76.100
Protein coverage (%)TK1151 99.604 / OH-1004 42.008
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G380810
LocationChr07:95448149-95450313 (+)
DescriptionSimilar to WAK2: Wall-associated receptor kinase 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g21270 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g21230 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g21250 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.
Oxygen-evolving enhancer protein 2 is phosphorylated by glycine-rich protein 3/wall-associated kinase 1 in Arabidopsis.2003 · DOI: 10.1016/s0006-291x(03)00851-9
Aluminum-induced gene expression and protein localization of a cell wall-associated receptor kinase in Arabidopsis.2003 · DOI: 10.1104/pp.103.022129
At1g21210 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.
Antisense expression of a cell wall-associated protein kinase, WAK4, inhibits cell elongation and alters morphology.2001 · DOI: 10.1105/tpc.13.6.1317

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_030135 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007166 cell surface receptor signaling pathway Biological Process
GO:0009311 oligosaccharide metabolic process Biological Process
GO:0009751 response to salicylic acid Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0009992 intracellular water homeostasis Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005509 calcium ion binding Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0030247 polysaccharide binding Molecular Function
KEGG gene cross-reference
ath:AT1G21230
ath:AT1G21270
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.865
Rank 1 · TkA07G380810 · TK1151
Cytoplasm0.082
Rank 2 · TkA07G380810 · TK1151
Endoplasmic reticulum0.074
Rank 3 · TkA07G380810 · TK1151
Nucleus0.052
Rank 4 · TkA07G380810 · TK1151
Lysosome / Vacuole0.027
Rank 5 · TkA07G380810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12662cEGF192-196 aa
PF12661hEGF192-196 aa
PF07645EGF_CA195-225 aa
PF00008EGF195-226 aa
PF14670FXa_inhibition199-225 aa
PF12947EGF_3210-226 aa
PF12661hEGF211-223 aa
PF12662cEGF214-238 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G380810PF12662cEGF1921960.0004420.8
TkA07G380810PF12661hEGF1921960.04714.9
TkA07G380810PF07645EGF_CA1952252.7e-0731.4
TkA07G380810PF00008EGF1952260.003518.3
TkA07G380810PF14670FXa_inhibition1992250.0009420.0
TkA07G380810PF12947EGF_32102260.002918.5
TkA07G380810PF12661hEGF2112230.04714.9
TkA07G380810PF12662cEGF2142380.0004420.8
TkA07G380810PF07645EGF_CA2352662.7e-0731.4
TkA07G380810PF14670FXa_inhibition2392680.0009420.0
TkA07G380810PF12947EGF_32392700.002918.5
TkA07G380810PF00008EGF2432620.003518.3
TkA07G380810PF12661hEGF2502620.04714.9
TkA07G380810PF12662cEGF2562700.0004420.8
TkA07G380810PF14670FXa_inhibition2712780.0009420.0
TkA07G380810PF30242YopI2953530.1313.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LMP1Arabidopsis thalianasp|Q9LMP1|WAK2_ARATH Wall-associated receptor kinase 237.900%Swiss-ProtMedium
Q9LMN7Arabidopsis thalianasp|Q9LMN7|WAK5_ARATH Wall-associated receptor kinase 535.100%Swiss-ProtMedium
Q39191Arabidopsis thalianasp|Q39191|WAK1_ARATH Wall-associated receptor kinase 134.000%Swiss-ProtMedium
Q9LMN6Arabidopsis thalianasp|Q9LMN6|WAK4_ARATH Wall-associated receptor kinase 432.900%Swiss-ProtMedium

JBrowse

View in Genome Browser