TkA07G379020 | RubberDandelionOmics

Gene overview

TkA07G379020

Reference: TK1151 Chr: Chr07 Coordinates: 94983911-94984327 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

417 bp · TkA07G379020|TK1151|cDNA

ATGGTGAAATTCTCACCACTTTCATCCATTCTTCTTGCATTTGCATTTGCTTTTGTTCAGTCGTCGAACGCCACCAAAAACCACCCATCTCCGCCAACACCATCCCCGGCACCACAATTGTCAACACCGCAACTAACACCATCGTGTGATGTTCTAATGTTCAAGATGATTGATTGCTTACCGTATCTTACAAAAGATCGAAAATGGCTACCCCTGTTGAATCTTGTGTTCAGGATTTTAGACGTGTGGAAGCTTGATTC...

CDS

Download CDS FASTA

417 bp · TkA07G379020|TK1151|CDS

ATGGTGAAATTCTCACCACTTTCATCCATTCTTCTTGCATTTGCATTTGCTTTTGTTCAGTCGTCGAACGCCACCAAAAACCACCCATCTCCGCCAACACCATCCCCGGCACCACAATTGTCAACACCGCAACTAACACCATCGTGTGATGTTCTAATGTTCAAGATGATTGATTGCTTACCGTATCTTACAAAAGATCGAAAATGGCTACCCCTGTTGAATCTTGTGTTCAGGATTTTAGACGTGTGGAAGCTTGATTC...

Protein

Download Protein FASTA

138 aa · TkA07G379020|TK1151|PROTEIN

MVKFSPLSSILLAFAFAFVQSSNATKNHPSPPTPSPAPQLSTPQLTPSCDVLMFKMIDCLPYLTKDRKWLPLLNLVFRILDVWKLDSNCVCEALNGSVVLGFQLNMTRAVHVSSACGFQHVSLDKCIRKFFLLFFIHL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G379020`
TK1151 ID	TkA07G379020
OH-1004 ID	LXL04_038648
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	31.000
Protein coverage (%)	TK1151 60.870 / OH-1004 47.222 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G379020`
Location	Chr07:94983911-94984327 (+)
Description	Similar to At5g64080: Non-specific lipid-transfer protein-like protein At5g64080
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038648` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006869 lipid transport Biological Process GO:0010089 xylem development Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009536 plastid Cellular Component GO:0016020 membrane Cellular Component GO:0098552 side of membrane Cellular Component GO:0008289 lipid binding Molecular Function
KEGG gene cross-reference	ath:AT1G36150 ath:AT2G13820 ath:AT4G08670 ath:AT5G09370 ath:AT5G64080 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.360

Rank 1 · TkA07G379020 · TK1151

Endoplasmic reticulum0.262

Rank 2 · TkA07G379020 · TK1151

Cytoplasm0.167

Rank 3 · TkA07G379020 · TK1151

Cell membrane0.131

Rank 4 · TkA07G379020 · TK1151

Lysosome / Vacuole0.116

Rank 5 · TkA07G379020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14368LTP_239-126 aa

PF00234Tryp_alpha_amyl49-67 aa

PF18083PutA_N51-68 aa

PF00234Tryp_alpha_amyl82-122 aa

PF19202DUF587486-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G379020	`PF14368`	LTP_2	39	126	2.8e-07	31.3
TkA07G379020	`PF00234`	Tryp_alpha_amyl	49	67	0.0079	17.1
TkA07G379020	`PF18083`	PutA_N	51	68	0.23	12.2
TkA07G379020	`PF00234`	Tryp_alpha_amyl	82	122	0.0079	17.1
TkA07G379020	`PF19202`	DUF5874	86	127	0.21	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card