TkA07G378820 | RubberDandelionOmics

Gene overview

TkA07G378820

Reference: TK1151 Chr: Chr07 Coordinates: 94952753-94955777 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1374 bp · TkA07G378820|TK1151|cDNA

AACAACATTACGTGTTTCCAAATGTGTGGAAATCCTGAAATTTAAAACTTTCTTCTTCTCATATTATCACATCATGATCATCAGCCAATTGTTCTTCTTCTTCTTCACCCACCCCCACTTCATCGGATACTCCAATAATCCCCACCAAGAAACAATTAACAACACATCCATTTCGCCATTTAATTGTTTTCTATTCGTTCCGTTTTAGATCTCCGCAAAGTTCCTGTTCATATCGTCTTCACAATCCCAGATTCCAGAAC...

CDS

Download CDS FASTA

909 bp · TkA07G378820|TK1151|CDS

ATGCAGGACCTGTTATTGAGCTATGAATCCCCCACTCAAGAAATCAAACTCAAATCTTCCATTGACGCCAGAAGATCAAAAAAAATGATCATTGAGGTGCGTGAAACGATCAAGAAACACAAATCACTGGAGAAGATCAAACAGCAGCGTCCAGATGAGTTTTCTCGTTTTTGTTCAGATGATTCAGTATCAAGATATCTAAGAGCACGAAACTGGAACGTTAAGAAGGCTGTTAAAATGCTCGAAACTTCATTGATTTG...

Protein

Download Protein FASTA

302 aa · TkA07G378820|TK1151|PROTEIN

MQDLLLSYESPTQEIKLKSSIDARRSKKMIIEVRETIKKHKSLEKIKQQRPDEFSRFCSDDSVSRYLRARNWNVKKAVKMLETSLIWRMNYKPEEIRWENVAAEAETGKIYRSSFKDKHGRVVLVMRPKFQNSKSTKSQIKYLVYCMENAIQNLPPNQEQMIWLIDFAGFNLSNISINSTKETANILQNQYPERLGLAILYNPPKFFEPFYKIVKPFLEPKTANKVKFVYADDPNTKGIMDSLFCMDELESAFGGKDEEY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G378820`
TK1151 ID	TkA07G378820
OH-1004 ID	LXL04_008936
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	52.900
Protein coverage (%)	TK1151 72.848 / OH-1004 70.607 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G378820`
Location	Chr07:94952753-94955777 (+)
Description	Similar to SPCC23B6.04c: CRAL-TRIO domain-containing protein C23B6.04c (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008936` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006658 phosphatidylserine metabolic process Biological Process GO:0008654 phospholipid biosynthetic process Biological Process GO:0009395 phospholipid catabolic process Biological Process GO:0009410 response to xenobiotic stimulus Biological Process GO:0015914 phospholipid transport Biological Process GO:0016126 sterol biosynthetic process Biological Process GO:0043001 Golgi to plasma membrane protein transport Biological Process GO:0120010 intermembrane phospholipid transfer Biological Process GO:1901352 negative regulation of phosphatidylglycerol biosynthetic process Biological Process GO:2001247 positive regulation of phosphatidylcholine biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005768 endosome Cellular Component
KEGG gene cross-reference	ago:AGOS_AER041W ddi:DDB_G0269182 sce:YNL231C sce:YNL264C spo:2539120 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.455

Rank 1 · TkA07G378820 · TK1151

Endoplasmic reticulum0.192

Rank 2 · TkA07G378820 · TK1151

Mitochondrion0.176

Rank 3 · TkA07G378820 · TK1151

Cell membrane0.158

Rank 4 · TkA07G378820 · TK1151

Nucleus0.147

Rank 5 · TkA07G378820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17303DUF535217-90 aa

PF03765CRAL_TRIO_N58-82 aa

PF00650CRAL_TRIO64-76 aa

PF09917DUF214765-127 aa

PF00650CRAL_TRIO106-255 aa

PF13716CRAL_TRIO_2120-234 aa

PF08281Sigma70_r4_2146-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G378820	`PF17303`	DUF5352	17	90	0.019	15.5
TkA07G378820	`PF03765`	CRAL_TRIO_N	58	82	8.2e-08	33.0
TkA07G378820	`PF00650`	CRAL_TRIO	64	76	1.8e-34	119.5
TkA07G378820	`PF09917`	DUF2147	65	127	0.2	13.0
TkA07G378820	`PF00650`	CRAL_TRIO	106	255	1.8e-34	119.5
TkA07G378820	`PF13716`	CRAL_TRIO_2	120	234	7.3e-10	40.0
TkA07G378820	`PF08281`	Sigma70_r4_2	146	175	0.28	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card