TkA07G376090 | RubberDandelionOmics

Gene overview

TkA07G376090

Reference: TK1151 Chr: Chr07 Coordinates: 94377298-94380161 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2764 bp · TkA07G376090|TK1151|cDNA

GAAGATGATAGGATGATAGATGGAGAGAAGGTGTCGTGTAGAAAATTACCTCCAATCGCCCAGAAGCTGATCGCACACAGGTAGTAGTTAAATCGGTTGTGGTAAGCATCGAATTAGATAGGTGTTTATATGTAGGGGAGGCTCAGAGCTGTAGTTAGAAACCGTCAAAAGGGGATCCAACACCGCCATGGCTGCAAACAACGGTTGCATCATCCAATCGGAGATACCTTCCGAGTTGCCCTGCCAAGATACGACGCTGA...

CDS

Download CDS FASTA

1137 bp · TkA07G376090|TK1151|CDS

ATGGCTTCCTCAATGCTCAGTGGTCTTCCACCCCCGATCTCCGTTCACCCGGCTCTCTCTTTCCGGTCAGTACACACACTTTCCTTCATGGAATCGCAGCCAGCTAATGCTACCGACGGCCTCGATTGCCTCCCTGACCCAATCATTCTTATAATCTTCAACAATATTTCCGATATAAAAACCCTAATCCGATGCCGTGCTGTGTCACGCCGGTTTAACTCACTTGTACCTCAAACGGACTCGCTCCTCCTCCGAGTCGA...

Protein

Download Protein FASTA

378 aa · TkA07G376090|TK1151|PROTEIN

MASSMLSGLPPPISVHPALSFRSVHTLSFMESQPANATDGLDCLPDPIILIIFNNISDIKTLIRCRAVSRRFNSLVPQTDSLLLRVDRVISSVDSEDDGDASSVIGFIKSIVKSIQDLISPTQDHTLQSSSNQQQSQNSPAMILRGFERIKELEIELPTGDLRLEKRAGIKWKAEFGKTLKSCVILGHRCGGVGESDLGGGGGLKTRVVWTISALIAASARHYMVKEIVKENPHLSRLIVKDRDGEGTVIMDESGIKEFR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G376090`
TK1151 ID	TkA07G376090
OH-1004 ID	LXL04_021073
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	34.400
Protein coverage (%)	TK1151 92.328 / OH-1004 99.455 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G376090

Location Chr07:94377298-94380161 (-)

Description Similar to At5g46170: F-box protein At5g46170

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78100`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	AUXIN UP-REGULATED F-BOX PROTEIN1 regulates the cross talk between auxin transport and cytokinin signaling during plant root growth.2011 · DOI: 10.1104/pp.111.179812
`At1g22220`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At4g18380`	F-box protein At4g18380.	No verified direct reference in this release
`At5g46170`	F-box protein At5g46170.	No verified direct reference in this release
`At1g30200`	F-box protein At1g30200.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021073 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0010286 heat acclimation Biological Process

GO:0010540 basipetal auxin transport Biological Process

GO:0010541 acropetal auxin transport Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G22220

ath:AT1G30200

ath:AT1G78100

ath:AT4G18380

ath:AT5G46170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.516

Rank 1 · TkA07G376090 · TK1151

Cytoplasm0.354

Rank 2 · TkA07G376090 · TK1151

Cell membrane0.197

Rank 3 · TkA07G376090 · TK1151

Endoplasmic reticulum0.104

Rank 4 · TkA07G376090 · TK1151

Plastid0.041

Rank 5 · TkA07G376090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box41-76 aa

PF12937F-box-like42-79 aa

PF29466F-box_COS11143-76 aa

PF24355DUF7514123-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G376090	`PF00646`	F-box	41	76	0.00011	22.7
TkA07G376090	`PF12937`	F-box-like	42	79	1.9e-06	28.2
TkA07G376090	`PF29466`	F-box_COS111	43	76	0.0073	17.6
TkA07G376090	`PF24355`	DUF7514	123	157	0.094	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9S2`	Arabidopsis thaliana	sp\|Q9C9S2\|AUF1_ARATH F-box protein AUF1	44.500%	Swiss-Prot	Medium
`Q9LM18`	Arabidopsis thaliana	sp\|Q9LM18\|AUF2_ARATH F-box protein AUF2	43.000%	Swiss-Prot	Medium
`O49508`	Arabidopsis thaliana	sp\|O49508\|FB237_ARATH F-box protein At4g18380	35.400%	Swiss-Prot	Medium
`Q9FNK5`	Arabidopsis thaliana	sp\|Q9FNK5\|FB285_ARATH F-box protein At5g46170	34.800%	Swiss-Prot	Medium
`Q9C534`	Arabidopsis thaliana	sp\|Q9C534\|FB19_ARATH F-box protein At1g30200	33.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card