TkA07G371840 | RubberDandelionOmics

Gene overview

TkA07G371840

Reference: TK1151 Chr: Chr07 Coordinates: 93259838-93260938 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1062 bp · TkA07G371840|TK1151|cDNA

ATGCGTAATATTTACTGGAAATCCGGGTTAGGAAACGACACATATGCACCGCCTTTTATGTTTGAAGAAGGTCAAATCCCGACGATGAAAAGCTCTATACAAGAAGCGGAGGAAGGGATATTTTCCGTCGTCGATTCCCTTCTCTCAAAAACCCAAATCCTGCCCGAGGAAATAGATGCCGTGATCGTTACCTGCGGATGCTTTTCACCATCTCCTTCTCTTTCATCTCTTATTGTGAATCACTACAATCTGAATCCCGA...

CDS

Download CDS FASTA

1062 bp · TkA07G371840|TK1151|CDS

ATGCGTAATATTTACTGGAAATCCGGGTTAGGAAACGACACATATGCACCGCCTTTTATGTTTGAAGAAGGTCAAATCCCGACGATGAAAAGCTCTATACAAGAAGCGGAGGAAGGGATATTTTCCGTCGTCGATTCCCTTCTCTCAAAAACCCAAATCCTGCCCGAGGAAATAGATGCCGTGATCGTTACCTGCGGATGCTTTTCACCATCTCCTTCTCTTTCATCTCTTATTGTGAATCACTACAATCTGAATCCCGA...

Protein

Download Protein FASTA

353 aa · TkA07G371840|TK1151|PROTEIN

MRNIYWKSGLGNDTYAPPFMFEEGQIPTMKSSIQEAEEGIFSVVDSLLSKTQILPEEIDAVIVTCGCFSPSPSLSSLIVNHYNLNPDVKTYNLSGMGCSSGVISIDLAAQILRGGGRKIRNVLVVVTENITLNWYEGEDRSMLVTNCIFRVGCAAAMITNDPSRRSSAKMELTHSLRTHHGADDSSYHAAFQKEDMNGVTGVSLTKDLIRVAAVNLREHIKILAPKVLPLSQLVSYAYSVVATALTAFEHICVHTGGKAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G371840`
TK1151 ID	TkA07G371840
OH-1004 ID	LXL04_030031
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	96.200
Protein coverage (%)	TK1151 100.000 / OH-1004 76.409 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G371840

Location Chr07:93259838-93260938 (-)

Description Similar to KCS1: 3-ketoacyl-CoA synthase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43760`	Mediates the synthesis of VLCFAs from 22 to 26 carbons in length (e.g. C22, C24, C26).	Specific and differential inhibition of very-long-chain fatty acid elongases from Arabidopsis thaliana by different herbicides.2004 · DOI: 10.1073/pnas.0404600101
`At2g46720`	Contributes to cuticular wax and suberin biosynthesis (By similarity).	No verified direct reference in this release
`At1g01120`	Contributes to cuticular wax and suberin biosynthesis.	KCS1 encodes a fatty acid elongase 3-ketoacyl-CoA synthase affecting wax biosynthesis in Arabidopsis thaliana.1999 · DOI: 10.1046/j.1365-313x.1999.00352.x Specific and differential inhibition of very-long-chain fatty acid elongases from Arabidopsis thaliana by different herbicides.2004 · DOI: 10.1073/pnas.0404600101 Substrate specificity of Arabidopsis 3-ketoacyl-CoA synthases.2006 · DOI: 10.1016/j.bbrc.2006.05.162
`At4g34510`	Active on saturated acyl-CoAs up to C22.	Substrate specificity of Arabidopsis 3-ketoacyl-CoA synthases.2006 · DOI: 10.1016/j.bbrc.2006.05.162
`At1g19440`	3-ketoacyl-CoA synthase 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030031 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000038 very long-chain fatty acid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0030497 fatty acid elongation Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0160062 cutin-based cuticle development Biological Process

KEGG gene cross-reference

ath:AT1G01120

ath:AT1G04220

ath:AT1G19440

ath:AT2G26640

ath:AT2G46720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.612

Rank 1 · TkA07G371840 · TK1151

Peroxisome0.120

Rank 2 · TkA07G371840 · TK1151

Cytoplasm0.120

Rank 3 · TkA07G371840 · TK1151

Cell membrane0.075

Rank 4 · TkA07G371840 · TK1151

Mitochondrion0.071

Rank 5 · TkA07G371840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08392FAE1_CUT1_RppA2-243 aa

PF08541ACP_syn_III_C48-63 aa

PF00195Chal_sti_synt_N79-162 aa

PF08545ACP_syn_III97-163 aa

PF08541ACP_syn_III_C249-330 aa

PF02797Chal_sti_synt_C252-329 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G371840	`PF08392`	FAE1_CUT1_RppA	2	243	2.5e-93	313.3
TkA07G371840	`PF08541`	ACP_syn_III_C	48	63	3.1e-11	44.0
TkA07G371840	`PF00195`	Chal_sti_synt_N	79	162	0.0017	18.6
TkA07G371840	`PF08545`	ACP_syn_III	97	163	0.0003	21.3
TkA07G371840	`PF08541`	ACP_syn_III_C	249	330	3.1e-11	44.0
TkA07G371840	`PF02797`	Chal_sti_synt_C	252	329	5e-07	30.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FG87`	Arabidopsis thaliana	sp\|Q9FG87\|KCS20_ARATH 3-ketoacyl-CoA synthase 20	46.800%	Swiss-Prot	Medium
`Q9ZUZ0`	Arabidopsis thaliana	sp\|Q9ZUZ0\|KCS13_ARATH 3-ketoacyl-CoA synthase 13	47.400%	Swiss-Prot	Medium
`Q9MAM3`	Arabidopsis thaliana	sp\|Q9MAM3\|KCS1_ARATH 3-ketoacyl-CoA synthase 1	47.200%	Swiss-Prot	Medium
`O65677`	Arabidopsis thaliana	sp\|O65677\|KCS17_ARATH 3-ketoacyl-CoA synthase 17	44.500%	Swiss-Prot	Medium
`Q9LN49`	Arabidopsis thaliana	sp\|Q9LN49\|KCS4_ARATH 3-ketoacyl-CoA synthase 4	43.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card