TkA07G365950 | RubberDandelionOmics

Gene overview

TkA07G365950

Reference: TK1151 Chr: Chr07 Coordinates: 91680830-91682053 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

579 bp · TkA07G365950|TK1151|cDNA

TGTCAAAACACAGAAAAGACATGGTACGTTGTTGATGCAAGTGATAAAATTCTCGGAAGGCTAGCATCAGCCATAGTCGTTCACATCCGTGGGAAGAATCTTGCAACCTATACTCCTAGTGTTGACATGGGAGCATTTGTTATTGTGGGATCACTAGATTCCAAACTAGGGCTGAAGAATTTGAAACGCTACAGAATCGTTCAACATGTGAATAAGGCTGTTACAAGGTATAAATTAAATAAAACCAACAAAGCAAAGTT...

CDS

Download CDS FASTA

579 bp · TkA07G365950|TK1151|CDS

TGTCAAAACACAGAAAAGACATGGTACGTTGTTGATGCAAGTGATAAAATTCTCGGAAGGCTAGCATCAGCCATAGTCGTTCACATCCGTGGGAAGAATCTTGCAACCTATACTCCTAGTGTTGACATGGGAGCATTTGTTATTGTGGGATCACTAGATTCCAAACTAGGGCTGAAGAATTTGAAACGCTACAGAATCGTTCAACATGTGAATAAGGCTGTTACAAGGTATAAATTAAATAAAACCAACAAAGCAAAGTT...

Protein

Download Protein FASTA

192 aa · TkA07G365950|TK1151|PROTEIN

CQNTEKTWYVVDASDKILGRLASAIVVHIRGKNLATYTPSVDMGAFVIVGSLDSKLGLKNLKRYRIVQHVNKAVTRYKLNKTNKAKFSPTVWSFPKCNQQEGDWECGYYVMCWMHEFVLSRQFDFPNSNWKDDGPYSDEQLERRVNSWVNSFGNEHLRQKGKMVLYSIQKVTFTLFFMVNMLDSKNFLDLMR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G365950`
TK1151 ID	TkA07G365950
OH-1004 ID	LXL04_003478
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.300
Protein coverage (%)	TK1151 56.250 / OH-1004 32.239 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G365950

Location Chr07:91680830-91682053 (+)

Description Similar to Polyubiquitin (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78630`	Large ribosomal subunit protein uL13c.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003478 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0019941 modification-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003735 structural constituent of ribosome Molecular Function

GO:0031386 protein tag activity Molecular Function

KEGG gene cross-reference

ath:AT4G05050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.848

Rank 1 · TkA07G365950 · TK1151

Cytoplasm0.214

Rank 2 · TkA07G365950 · TK1151

Mitochondrion0.034

Rank 3 · TkA07G365950 · TK1151

Cell membrane0.026

Rank 4 · TkA07G365950 · TK1151

Endoplasmic reticulum0.020

Rank 5 · TkA07G365950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00572Ribosomal_L136-49 aa

PF02902Peptidase_C4832-130 aa

PF26668DUF822350-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G365950	`PF00572`	Ribosomal_L13	6	49	9.1e-14	52.3
TkA07G365950	`PF02902`	Peptidase_C48	32	130	0.0001	23.0
TkA07G365950	`PF26668`	DUF8223	50	124	0.12	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SYL9`	Arabidopsis thaliana	sp\|Q9SYL9\|RK13_ARATH Large ribosomal subunit protein uL13c	68.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card