TkA07G363730 | RubberDandelionOmics

Gene overview

TkA07G363730

Reference: TK1151 Chr: Chr07 Coordinates: 91155765-91163039 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2976 bp · TkA07G363730|TK1151|cDNA

ATGGGAATTCAACTCCTAACCATGTTTGGAGCTGAGAAGATTGTAACTGGGCTGCTGGAATTAGAATGGACTTGTAGTTGGGCTCTGGAATGGACAACAAGTAGCTGGGCTGGATTGCTGAAATCTTCTATCCTCCTTCCGATCTTGACGTTATCGTCAGTTCGGCTTTGCAGATCTGCTATCAGCTCGTCCTTGTCGAGATCTCAACTTCATCTTCGTGAAGTCGTTGATCTCTCATCGACTGATCTGTCCTGGATATT...

CDS

Download CDS FASTA

2976 bp · TkA07G363730|TK1151|CDS

ATGGGAATTCAACTCCTAACCATGTTTGGAGCTGAGAAGATTGTAACTGGGCTGCTGGAATTAGAATGGACTTGTAGTTGGGCTCTGGAATGGACAACAAGTAGCTGGGCTGGATTGCTGAAATCTTCTATCCTCCTTCCGATCTTGACGTTATCGTCAGTTCGGCTTTGCAGATCTGCTATCAGCTCGTCCTTGTCGAGATCTCAACTTCATCTTCGTGAAGTCGTTGATCTCTCATCGACTGATCTGTCCTGGATATT...

Protein

Download Protein FASTA

991 aa · TkA07G363730|TK1151|PROTEIN

MGIQLLTMFGAEKIVTGLLELEWTCSWALEWTTSSWAGLLKSSILLPILTLSSVRLCRSAISSSLSRSQLHLREVVDLSSTDLSWILQLFLELLVYPLFTVQLILADSHKSQYFDLGRALCTLGGCQPWRVTPRRPDTGEKEEEILPVPWLSPVNPLVQRVSLSRPRSDLRSGARRPPDYRLAFFATLVLLHLFYLLYFICKSCLVKKKKIKGLAQGEIKIIMLVLILMILLFFILNDLSCVAIVNFKLQGTENYKAWSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G363730`
TK1151 ID	TkA07G363730
OH-1004 ID	LXL04_039767
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	46.900
Protein coverage (%)	TK1151 68.517 / OH-1004 45.684 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G363730

Location Chr07:91155765-91163039 (-)

Description Similar to At1g53430: Probable LRR receptor-like serine/threonine-protein kinase At1g53430

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P92519`	Uncharacterized mitochondrial protein AtMg00810.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039767 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009861 jasmonic acid and ethylene-dependent systemic resistance Biological Process

GO:0031667 response to nutrient levels Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G07650

ath:AT1G53420

ath:AT1G53430

ath:AT1G53440

ath:AT3G14840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.527

Rank 1 · TkA07G363730 · TK1151

Nucleus0.360

Rank 2 · TkA07G363730 · TK1151

Mitochondrion0.103

Rank 3 · TkA07G363730 · TK1151

Endoplasmic reticulum0.070

Rank 4 · TkA07G363730 · TK1151

Cell membrane0.055

Rank 5 · TkA07G363730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14223Retrotran_gag_256-71 aa

PF13976gag_pre-integrs200-208 aa

PF14244Retrotran_gag_3243-283 aa

PF14223Retrotran_gag_2266-374 aa

PF04003Utp12326-396 aa

PF22936Pol_BBD534-610 aa

PF13976gag_pre-integrs616-654 aa

PF07727RVT_2719-761 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G363730	`PF14223`	Retrotran_gag_2	56	71	2.4e-06	28.1
TkA07G363730	`PF13976`	gag_pre-integrs	200	208	4.4e-08	33.5
TkA07G363730	`PF14244`	Retrotran_gag_3	243	283	9.3e-06	26.1
TkA07G363730	`PF14223`	Retrotran_gag_2	266	374	2.4e-06	28.1
TkA07G363730	`PF04003`	Utp12	326	396	0.06	14.2
TkA07G363730	`PF22936`	Pol_BBD	534	610	2.6e-07	31.6
TkA07G363730	`PF13976`	gag_pre-integrs	616	654	4.4e-08	33.5
TkA07G363730	`PF07727`	RVT_2	719	761	4.5e-06	27.2
TkA07G363730	`PF04003`	Utp12	794	849	0.06	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92519`	Arabidopsis thaliana	sp\|P92519\|M810_ARATH Uncharacterized mitochondrial protein AtMg00810	36.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card