TkA07G358900 | RubberDandelionOmics

Gene overview

TkA07G358900

Reference: TK1151 Chr: Chr07 Coordinates: 89916116-89919736 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2105 bp · TkA07G358900|TK1151|cDNA

TTAACTGGAACTCTACTGGTCCGTAATGATCTGTAGAACTCTAGTATAAGTAAAGCATTCAAGTGAAGGTTTAGCTATCAGGTGTTCACATACTCAGCTAGACAACACATATATAGATTCTCCTTCGTTCCCACAAAGACGGAGATAAAGAGATGGCGTCACTGCAGCATGAACCACGAGTTGGAGGGAGCAACCGCATTTCAGCTGTTGATATATCTTATATGGACAGTAACGACCATGAGAATAAAGATACGCTTCAT...

CDS

Download CDS FASTA

1623 bp · TkA07G358900|TK1151|CDS

ATGGCGTCACTGCAGCATGAACCACGAGTTGGAGGGAGCAACCGCATTTCAGCTGTTGATATATCTTATATGGACAGTAACGACCATGAGAATAAAGATACGCTTCATGAACAGAAACCTGGATGGAAAAAGTTTTTCTCCTTTGTTGGCCCTGGTTTCCTAGTTTCATTGGCGTATCTCGATCCTGGCAACATGGAAACTGATCTACAAGCAGGAGCTAATCACAGATACGAGCTACTTTGGGTGATTTTAATCGGGTT...

Protein

Download Protein FASTA

540 aa · TkA07G358900|TK1151|PROTEIN

MASLQHEPRVGGSNRISAVDISYMDSNDHENKDTLHEQKPGWKKFFSFVGPGFLVSLAYLDPGNMETDLQAGANHRYELLWVILIGLIFALVIQSLAANLGVSTGKHLSELCKAEYPIFVKYCLWLLAEVAVIAADIPEVIGTAFALNILFKIPVWVGVLLTGFSTLLLLGLQRYGVRKLEILIAILVFVMAGCFFGEMSYVSPPAGDVLKGMFVPKLSGQGATGDAIALLGALVMPHNLFLHSALVLTRKIPNSVRGIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G358900`
TK1151 ID	TkA07G358900
OH-1004 ID	LXL04_029909
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.700
Protein coverage (%)	TK1151 100.000 / OH-1004 96.447 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G358900

Location Chr07:89916116-89919736 (-)

Description Similar to NRAMP5: Metal transporter Nramp5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0257200`	Probable metal transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029909 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006828 manganese ion transport Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0030026 intracellular manganese ion homeostasis Biological Process

GO:0034755 iron ion transmembrane transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0005384 manganese ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

dosa:Os07g0257200

pop:18096211

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.461

Rank 1 · TkA07G358900 · TK1151

Lysosome / Vacuole0.322

Rank 2 · TkA07G358900 · TK1151

Cytoplasm0.161

Rank 3 · TkA07G358900 · TK1151

Endoplasmic reticulum0.091

Rank 4 · TkA07G358900 · TK1151

Golgi apparatus0.086

Rank 5 · TkA07G358900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01566Nramp52-449 aa

PF28863DUF8471168-200 aa

PF28863DUF8471395-444 aa

PF01566Nramp467-486 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G358900	`PF01566`	Nramp	52	449	9.7e-126	420.5
TkA07G358900	`PF28863`	DUF8471	168	200	0.12	12.8
TkA07G358900	`PF28863`	DUF8471	395	444	0.12	12.8
TkA07G358900	`PF01566`	Nramp	467	486	9.7e-126	420.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H4H5`	Oryza sativa subsp. japonica	sp\|Q8H4H5\|NRAM5_ORYSJ Metal transporter Nramp5	71.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card