RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G358790
Reference: TK1151 Chr: Chr07 Coordinates: 89898411-89901677 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2728 bp · TkA07G358790|TK1151|cDNA

GGGTGATGTTTTATCATTATTATTATCATTATTATAAACATCGTCTTATTCATGGGTAAATCTAGACCTCCATACTCCAAATTATGTAAAGAATCAAATGTGAAGCTCACTACACCTCCAATGGCAGCCACCTTCATCTTACACCTCTTCTTCCTCATACAATCTCTCCAAATCCACTATTCTGATTCTCAATCTCTCCAATCTCTACAAACTCTATTTACCACTTTCAATGCAAGAGGTACAAGTAATTACTGCCCGAG...

CDS

Download CDS FASTA

2466 bp · TkA07G358790|TK1151|CDS

ATGGGTAAATCTAGACCTCCATACTCCAAATTATGTAAAGAATCAAATGTGAAGCTCACTACACCTCCAATGGCAGCCACCTTCATCTTACACCTCTTCTTCCTCATACAATCTCTCCAAATCCACTATTCTGATTCTCAATCTCTCCAATCTCTACAAACTCTATTTACCACTTTCAATGCAAGAGGTACAAGTAATTACTGCCCGAGTAGTACTAGCAGCAGTGTCGCCATCAACCTTCCTACATTCATTCCAAACTC...

Protein

Download Protein FASTA

821 aa · TkA07G358790|TK1151|PROTEIN

MGKSRPPYSKLCKESNVKLTTPPMAATFILHLFFLIQSLQIHYSDSQSLQSLQTLFTTFNARGTSNYCPSSTSSSVAINLPTFIPNSSLTLICYNNIITQLHITGNNKNNFDHENLSTESFFNTISTIFPGLKVLSLVSLSLNGPLPASVLANSVSSLEILNVSSNCFHGDIPFELSYLKNLHTLVLDHNNFSGPVPDWIGYKLSSLTVLSFKNNSLDGYLPFSLARLVSLRVLDLSRNQLSGDVPVDFKNLTNLQVFDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G358790
TK1151 IDTkA07G358790
OH-1004 IDLXL04_011496
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)34.900
Protein coverage (%)TK1151 86.236 / OH-1004 90.350
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G358790
LocationChr07:89898411-89901677 (+)
DescriptionSimilar to At1g14390: Probable LRR receptor-like serine/threonine-protein kinase At1g14390
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g03770 Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770. No verified direct reference in this release
At1g14390 Probable LRR receptor-like serine/threonine-protein kinase At1g14390. No verified direct reference in this release
At2g02780 Probable LRR receptor-like serine/threonine-protein kinase At2g02780. No verified direct reference in this release
At5g54380 Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.
A receptor-like kinase mediates the response of Arabidopsis cells to the inhibition of cellulose synthesis.2007 · DOI: 10.1016/j.cub.2007.05.018
Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
At5g28680 Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_011496 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009416 response to light stimulus Biological Process
GO:0009729 detection of brassinosteroid stimulus Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0045088 regulation of innate immune response Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0016020 membrane Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005496 steroid binding Molecular Function
KEGG gene cross-reference
ath:AT1G14390
ath:AT2G02780
ath:AT3G03770
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.848
Rank 1 · TkA07G358790 · TK1151
Endoplasmic reticulum0.084
Rank 2 · TkA07G358790 · TK1151
Cytoplasm0.068
Rank 3 · TkA07G358790 · TK1151
Nucleus0.060
Rank 4 · TkA07G358790 · TK1151
Lysosome / Vacuole0.027
Rank 5 · TkA07G358790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30986E6-like27-97 aa
PF12799LRR_430-58 aa
PF23598LRR_1436-94 aa
PF13516LRR_695-107 aa
PF12799LRR_498-107 aa
PF00560LRR_199-112 aa
PF13855LRR_8100-109 aa
PF12799LRR_4123-142 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G358790PF30986E6-like27970.4511.5
TkA07G358790PF12799LRR_430581.4e-1454.5
TkA07G358790PF23598LRR_1436942.2e-0730.7
TkA07G358790PF13516LRR_6951070.01516.0
TkA07G358790PF12799LRR_4981071.4e-1454.5
TkA07G358790PF00560LRR_1991123.7e-1759.5
TkA07G358790PF13855LRR_81001091.6e-1557.3
TkA07G358790PF12799LRR_41231421.4e-1454.5
TkA07G358790PF23598LRR_141292632.2e-0730.7
TkA07G358790PF00560LRR_11321493.7e-1759.5
TkA07G358790PF24758LRR_At5g563701351920.1412.6
TkA07G358790PF13855LRR_81461921.6e-1557.3
TkA07G358790PF00560LRR_11571793.7e-1759.5
TkA07G358790PF12799LRR_41571971.4e-1454.5
TkA07G358790PF13516LRR_61571690.01516.0
TkA07G358790PF13516LRR_61801930.01516.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8LFN2Arabidopsis thalianasp|Q8LFN2|Y3037_ARATH Probable inactive leucine-rich repeat receptor-like protein kinase At3g0377050.100%Swiss-ProtHigh
Q9M9S4Arabidopsis thalianasp|Q9M9S4|Y1143_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g1439032.700%Swiss-ProtMedium
C0LGJ9Arabidopsis thalianasp|C0LGJ9|Y2278_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g0278035.800%Swiss-ProtLow
Q9LK35Arabidopsis thalianasp|Q9LK35|THE1_ARATH Receptor-like protein kinase THESEUS 132.100%Swiss-ProtLow
Q3E8W4Arabidopsis thalianasp|Q3E8W4|ANX2_ARATH Receptor-like protein kinase ANXUR230.900%Swiss-ProtLow

JBrowse

View in Genome Browser