TkA07G357490 | RubberDandelionOmics

Gene overview

TkA07G357490

Reference: TK1151 Chr: Chr07 Coordinates: 89551790-89553537 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1583 bp · TkA07G357490|TK1151|cDNA

GACAACCTAGGTTATTATATTATAAATTTATATTTGATCACTTTTCATATTTATTTATTTTGTTTACTGGTAATTTATATATTGGTTTACGATTATGTGTCATCGGCTAGCCGTTACCTCCCCTGTTACCCTCTCCTTGTCTCCGGTGTAACCCCGTCGTCAACCACCAACGATTGTCGGAAAACGGGAAGCCCAAACCCTCCGTCTCTACTGTAATTTCAGCACCCAATTATATGCAATAGGATATTAATCGGAAGATA...

CDS

Download CDS FASTA

1128 bp · TkA07G357490|TK1151|CDS

ATGAAGAGACACCGACCCATCCCGTCGCCGCCGTCAATAACCACGGCTACTCGAGAACCCATCCTCTCAAAAATCACCGCAAACAATTCCATATCCTCATACTACTCTTCCAAGAAACCTAGAAAACCCCTTCTTTCCGACCTCAAAACCCCCAAACGGGTAACCCTAAATCTAAACAAATCAGAGCTCTTTTTACCACTCACATTCCCCACCGGGCAAACATTCAGGTGGAAACAAACATCCCCTTCTCAATACACAGG...

Protein

Download Protein FASTA

375 aa · TkA07G357490|TK1151|PROTEIN

MKRHRPIPSPPSITTATREPILSKITANNSISSYYSSKKPRKPLLSDLKTPKRVTLNLNKSELFLPLTFPTGQTFRWKQTSPSQYTGVVGSHLVSLLQLQDANGTDVAYTFHNTPISNQSAAKSALLDFLNMSICLSDLWKEFSASDQRFAELAEHLSGARVLRQDPLECLIQFICSSNNNIKRITQMVDFISSLGNHLGVVEGIEFHEFPTLDRLSKVSEEELRKAGFGYRAKYITGTVQSLQSKPGGGEAWLASLRKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G357490`
TK1151 ID	TkA07G357490
OH-1004 ID	LXL04_029907
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G357490

Location Chr07:89551790-89553537 (-)

Description Similar to OGG1: N-glycosylase/DNA lyase OGG1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21710`	Involved in repair of DNA damaged by oxidation by incising DNA at 8-oxoG residues.	A functional OGG1 homologue from Arabidopsis thaliana.2001 · DOI: 10.1007/s004380000414 An OGG1 orthologue encoding a functional 8-oxoguanine DNA glycosylase/lyase in Arabidopsis thaliana.2001 · DOI: 10.1023/a:1013644026132 Arabidopsis thaliana Ogg1 protein excises 8-hydroxyguanine and 2,6-diamino-4-hydroxy-5-formamidopyrimidine from oxidatively damaged DNA containing multiple lesions.2003 · DOI: 10.1021/bi027226u Overexpression of AtOGG1, a DNA glycosylase/AP lyase, enhances seed longevity and abiotic stress tolerance in Arabidopsis.2012 · DOI: 10.1093/jxb/ers093

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029907 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006284 base-excision repair Biological Process

GO:0006285 base-excision repair, AP site formation Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006974 DNA damage response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009314 response to radiation Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0032355 response to estradiol Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

KEGG gene cross-reference

ath:AT1G21710

dme:Dmel_CG1795

hsa:4968

mmu:18294

rno:81528

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.667

Rank 1 · TkA07G357490 · TK1151

Plastid0.166

Rank 2 · TkA07G357490 · TK1151

Cytoplasm0.165

Rank 3 · TkA07G357490 · TK1151

Mitochondrion0.153

Rank 4 · TkA07G357490 · TK1151

Cell membrane0.010

Rank 5 · TkA07G357490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12799LRR_428-34 aa

PF07934OGG_N56-171 aa

PF26998DUF8323142-199 aa

PF00730HhH-GPD172-309 aa

PF12799LRR_4174-185 aa

PF12826HHH_2208-225 aa

PF14520HHH_5210-230 aa

PF00633HHH212-226 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G357490	`PF12799`	LRR_4	28	34	0.06	14.3
TkA07G357490	`PF07934`	OGG_N	56	171	4.2e-25	88.9
TkA07G357490	`PF26998`	DUF8323	142	199	0.079	13.9
TkA07G357490	`PF00730`	HhH-GPD	172	309	3.6e-10	40.9
TkA07G357490	`PF12799`	LRR_4	174	185	0.06	14.3
TkA07G357490	`PF12826`	HHH_2	208	225	0.00089	20.1
TkA07G357490	`PF14520`	HHH_5	210	230	0.11	13.7
TkA07G357490	`PF00633`	HHH	212	226	2.8e-05	24.4
TkA07G357490	`PF12799`	LRR_4	254	273	0.06	14.3
TkA07G357490	`PF21176`	RecR_HhH	263	291	5.7e-05	23.6
TkA07G357490	`PF12826`	HHH_2	263	291	0.00089	20.1
TkA07G357490	`PF14520`	HHH_5	265	281	0.11	13.7
TkA07G357490	`PF00633`	HHH	266	285	2.8e-05	24.4
TkA07G357490	`PF00730`	HhH-GPD	324	357	3.6e-10	40.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNY7`	Arabidopsis thaliana	sp\|Q9FNY7\|OGG1_ARATH N-glycosylase/DNA lyase OGG1	63.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card