TkA07G356280 | RubberDandelionOmics

Gene overview

TkA07G356280

Reference: TK1151 Chr: Chr07 Coordinates: 89192305-89197083 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2085 bp · TkA07G356280|TK1151|cDNA

TTCAATAGATCACATTATACGTTCCTTCTCCATTACGCCTCAAACACCGCATTTACCATGTTTTCTTCTGTAACGTATCCCGTCCGTTCCTTGCGATCGACTTCAGAAACCCTTTGCTGCTACCGTTCCTTGCGTGAAACACCAGCTTCACCCCGGCTCCCTCTCCATCTTCGGCGCCCTCTGGCCTCTCCAGCGACCGCTCCCTCTTACCAGAGACGTCCTCTCCAGCGCCGGCGACCGCTAACAGGCCTAACGCCATC...

CDS

Download CDS FASTA

1377 bp · TkA07G356280|TK1151|CDS

ATGTCGTCTCTAACACTGAAGACGACCGGTTCTTCCCTCCCACAGAATTCATTCGATTTCCCTCATGTCAATTCAGTGCATTCAGCTATGGTTGAGTTCGTTTCCTCTGTGAAATATCCTTTCTTCTACAGCACCAGATTCTGTAAACTTCAGATTGACATGGACACCATAGAAGTGAGCAACCTAAACAGGCAATTCTTATTTCGTCAATCACATGTTGGCCAATCCAAGGCAAAAGTTGCTCGCGATTCTGTCCTAAG...

Protein

Download Protein FASTA

458 aa · TkA07G356280|TK1151|PROTEIN

MSSLTLKTTGSSLPQNSFDFPHVNSVHSAMVEFVSSVKYPFFYSTRFCKLQIDMDTIEVSNLNRQFLFRQSHVGQSKAKVARDSVLRFRPQISITPYHANKACESPLFGRWCPLVESGTTGFLGQVTVHIKGQTECYECQPKPAPKTYPVCTITSTPSKFVHCIVWAKDLLFAKLFGDKNQDNDLNVRSNDTASSSSDHLEDVFERKKDEEIEQYGKRIFNHVFGHNIESALCNKEAWKNRNKPRPIYVKDVFSDETFQQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G356280`
TK1151 ID	TkA07G356280
OH-1004 ID	LXL04_038226
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	84.900
Protein coverage (%)	TK1151 72.926 / OH-1004 56.402 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G356280

Location Chr07:89192305-89197083 (-)

Description Similar to SAE2: SUMO-activating enzyme subunit 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21470`	The dimeric enzyme acts as an E1 ligase for SUMO1 and SUMO2.	Genetic analysis of SUMOylation in Arabidopsis: conjugation of SUMO1 and SUMO2 to nuclear proteins is essential.2007 · DOI: 10.1104/pp.107.102285

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038226 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0016925 protein sumoylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0031510 SUMO activating enzyme complex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016740 transferase activity Molecular Function

GO:0019948 SUMO activating enzyme activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G21470

dre:406672

xla:399235

xtr:549845

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.481

Rank 1 · TkA07G356280 · TK1151

Nucleus0.306

Rank 2 · TkA07G356280 · TK1151

Mitochondrion0.173

Rank 3 · TkA07G356280 · TK1151

Peroxisome0.122

Rank 4 · TkA07G356280 · TK1151

Endoplasmic reticulum0.087

Rank 5 · TkA07G356280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00899ThiF52-100 aa

PF00899ThiF112-394 aa

PF10585UBA_E1_SCCH157-199 aa

PF31277Damicornin176-241 aa

PF06078DUF937187-229 aa

PF31277Damicornin249-279 aa

PF10585UBA_E1_SCCH257-348 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G356280	`PF00899`	ThiF	52	100	1.6e-30	106.7
TkA07G356280	`PF00899`	ThiF	112	394	1.6e-30	106.7
TkA07G356280	`PF10585`	UBA_E1_SCCH	157	199	1e-10	42.7
TkA07G356280	`PF31277`	Damicornin	176	241	1.2	10.2
TkA07G356280	`PF06078`	DUF937	187	229	0.074	14.2
TkA07G356280	`PF31277`	Damicornin	249	279	1.2	10.2
TkA07G356280	`PF10585`	UBA_E1_SCCH	257	348	1e-10	42.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJT1`	Arabidopsis thaliana	sp\|Q9SJT1\|SAE2_ARATH SUMO-activating enzyme subunit 2	68.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card