TkA07G355460 | RubberDandelionOmics

Gene overview

TkA07G355460

Reference: TK1151 Chr: Chr07 Coordinates: 88958577-88964697 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2873 bp · TkA07G355460|TK1151|cDNA

TTCAGATGCAAGAATATTGGATGTGAATAATATAGGATGGAATAGAAATGGTTATCTCACCTTTGAGTTTACTGTAATCACATCAGGAAGTCTCTTACTTCATGTAAAATATGAAAACGTACATTTAATCCGTTCTCCTTTGACTTTCTCGGTTGACCCGGGACCACTTGATGTTGGCAACTGTGTGCCAAAGTGGGAAACTGTAACAAACAATTTTCAGCTGTTTTCCACGATGGAAACGTTTATAACTCAAAGAGATA...

CDS

Download CDS FASTA

2691 bp · TkA07G355460|TK1151|CDS

TCAGATGCAAGAATATTGGATGTGAATAATATAGGATGGAATAGAAATGGTTATCTCACCTTTGAGTTTACTGTAATCACATCAGGAAGTCTCTTACTTCATGTAAAATATGAAAACGTACATTTAATCCGTTCTCCTTTGACTTTCTCGGTTGACCCGGGACCACTTGATGTTGGCAACTGTGTGCCAAAGTGGGAAACTGTAACAAACAATTTTCAGCTGTTTTCCACGATGGAAACGTTTATAACTCAAAGAGATAG...

Protein

Download Protein FASTA

896 aa · TkA07G355460|TK1151|PROTEIN

SDARILDVNNIGWNRNGYLTFEFTVITSGSLLLHVKYENVHLIRSPLTFSVDPGPLDVGNCVPKWETVTNNFQLFSTMETFITQRDRFGNLVPGFYDFEFEVIEMHTRLALPIGDLKYEEVVSGIQSFSFKLLAPGEFLLIITDKDKKGILNIPYQFSIFIAYCDGLKSIVNGSGLLNSIAGQSSKFTILLRDAYEYPSPIELHRLRVQITLPTRSIHVEPRISPVDSVNGTLSTGMQSFGAFNPSVPSDYLQSNDVVTW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G355460`
TK1151 ID	TkA07G355460
OH-1004 ID	LXL04_029874
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.200
Protein coverage (%)	TK1151 100.000 / OH-1004 72.786 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G355460

Location Chr07:88958577-88964697 (+)

Description Similar to GEX2: Protein GAMETE EXPRESSED 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49150`	Protein GAMETE EXPRESSED 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029874 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0030036 actin cytoskeleton organization Biological Process

GO:0048235 pollen sperm cell differentiation Biological Process

GO:0061936 fusion of sperm to egg plasma membrane involved in double fertilization forming a zygote and endosperm Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT5G49150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.520

Rank 1 · TkA07G355460 · TK1151

Cytoplasm0.224

Rank 2 · TkA07G355460 · TK1151

Endoplasmic reticulum0.133

Rank 3 · TkA07G355460 · TK1151

Lysosome / Vacuole0.124

Rank 4 · TkA07G355460 · TK1151

Golgi apparatus0.112

Rank 5 · TkA07G355460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23616Ig_GEX2_N3-51 aa

PF00630Filamin14-47 aa

PF23616Ig_GEX2_N60-158 aa

PF00630Filamin165-288 aa

PF23616Ig_GEX2_N181-197 aa

PF17963Big_9283-331 aa

PF23616Ig_GEX2_N327-350 aa

PF00630Filamin360-398 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G355460	`PF23616`	Ig_GEX2_N	3	51	3.6e-17	63.1
TkA07G355460	`PF00630`	Filamin	14	47	2.7e-16	60.9
TkA07G355460	`PF23616`	Ig_GEX2_N	60	158	3.6e-17	63.1
TkA07G355460	`PF00630`	Filamin	165	288	2.7e-16	60.9
TkA07G355460	`PF23616`	Ig_GEX2_N	181	197	3.6e-17	63.1
TkA07G355460	`PF17963`	Big_9	283	331	1.8e-10	42.3
TkA07G355460	`PF23616`	Ig_GEX2_N	327	350	3.6e-17	63.1
TkA07G355460	`PF00630`	Filamin	360	398	2.7e-16	60.9
TkA07G355460	`PF17892`	Cadherin_5	362	370	1.9e-05	25.1
TkA07G355460	`PF17963`	Big_9	406	490	1.8e-10	42.3
TkA07G355460	`PF17803`	Cadherin_4	406	493	2.1e-07	32.0
TkA07G355460	`PF17892`	Cadherin_5	445	488	1.9e-05	25.1
TkA07G355460	`PF28974`	GEX2	458	482	2.4e-40	137.1
TkA07G355460	`PF28974`	GEX2	520	620	2.4e-40	137.1
TkA07G355460	`PF17963`	Big_9	587	607	1.8e-10	42.3
TkA07G355460	`PF17803`	Cadherin_4	640	690	2.1e-07	32.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K4R6`	Arabidopsis thaliana	sp\|F4K4R6\|GEX2_ARATH Protein GAMETE EXPRESSED 2	44.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card