RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G354320
Reference: TK1151 Chr: Chr07 Coordinates: 88630264-88633177 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2786 bp · TkA07G354320|TK1151|cDNA

TTTATACTGGCATGTTTTACTTGATGTTTTGTTTTCCTGTAAAAGCCATCCCGTCTATCATCACAGATTCATTTCATGGGTTCTTTTTCCACGTTGACGTGGGTATTGTATAATTTTCATTGCTGATATTTATTTCGTAGTATTATTGGGGACCATGATTATGAATCAACGTTAGCAACTTCAAATTTTTTCCACACGCTTTCAAGACCTCAATGAATTCCACAATGGTAGTAAATGACTAAATGTATTTAGTGGTCCCC...

CDS

Download CDS FASTA

1962 bp · TkA07G354320|TK1151|CDS

ATGGTTGGTTGCTTCTCCACACTAATGGCGGTAAGGATAAAAACATCACAGGTCAGATATCTCAAGCGACTTCTGCTTCTATCCTTGATTCGGCACTACGCGACTGGAAAATTCATTCTGAAAATGATGCTCCAAGGATACCTTTCGGCTTTCCCGATAATTGGGTCTTCCGATGATACTTATAGCAGATACTGGTCAACTGACACGTTATCTACGGATACAGAGTCGTTATACCTCAGCCCTAATGGGTCTCTGATTTT...

Protein

Download Protein FASTA

653 aa · TkA07G354320|TK1151|PROTEIN

MVGCFSTLMAVRIKTSQVRYLKRLLLLSLIRHYATGKFILKMMLQGYLSAFPIIGSSDDTYSRYWSTDTLSTDTESLYLSPNGSLILVQYNGTRMVVNKPTSSESGMDYEAVIFRATLDWDGNFVLYSHRFTNSSSVMKIEWKALQDPCQAKGICGFNSYCTSIDGEFQCHCLPGFVDLNDTRDVKYYGCYRNFTDEEACNRKGLELSYNVTELDNMDLLAYKSYSVMKLSKDDCRRSCFDDCNCWASLYYGDGNCKKLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G354320
TK1151 IDTkA07G354320
OH-1004 IDLXL04_029855
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)97.600
Protein coverage (%)TK1151 95.406 / OH-1004 81.332
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G354320
LocationChr07:88630264-88633177 (-)
DescriptionSimilar to LECRK1: G-type lectin S-receptor-like serine/threonine-protein kinase LECRK1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0201900 Involved in innate immunity. No verified direct reference in this release
UniProt: A0A075F7E9 Involved in innate immunity. No verified direct reference in this release
Os04g0202500 Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH). No verified direct reference in this release
UniProt: Q25AG3 Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH). No verified direct reference in this release
UniProt: Q25AG2 Does not seem to be involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH). No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_029855 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0051707 response to other organism Biological Process
GO:0016020 membrane Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0030246 carbohydrate binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
dosa:Os04g0201900
dosa:Os04g0202500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.843
Rank 1 · TkA07G354320 · TK1151
Endoplasmic reticulum0.092
Rank 2 · TkA07G354320 · TK1151
Cytoplasm0.077
Rank 3 · TkA07G354320 · TK1151
Nucleus0.043
Rank 4 · TkA07G354320 · TK1151
Lysosome / Vacuole0.034
Rank 5 · TkA07G354320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00954S_locus_glycop111-177 aa
PF00008EGF146-177 aa
PF07645EGF_CA149-177 aa
PF12947EGF_3152-177 aa
PF25478EGF_Mua-3154-183 aa
PF12661hEGF155-176 aa
PF08276PAN_2212-247 aa
PF08277PAN_3222-257 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G354320PF00954S_locus_glycop1111773.7e-0524.9
TkA07G354320PF00008EGF1461770.08313.9
TkA07G354320PF07645EGF_CA1491770.9710.4
TkA07G354320PF12947EGF_31521770.01516.3
TkA07G354320PF25478EGF_Mua-31541830.04214.6
TkA07G354320PF12661hEGF1551760.2612.5
TkA07G354320PF08276PAN_22122470.002718.5
TkA07G354320PF08277PAN_32222570.02415.2
TkA07G354320PF12947EGF_32432550.01516.3
TkA07G354320PF07714PK_Tyr_Ser-Thr3736326.4e-41141.1
TkA07G354320PF00069Pkinase3746313.3e-37129.0
TkA07G354320PF03109ABC13754030.05813.2
TkA07G354320PF03109ABC14805290.05813.2
TkA07G354320PF07645EGF_CA4844930.9710.4
TkA07G354320PF14531Kinase-like4885710.1512.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q7FAZ3Oryza sativa subsp. japonicasp|Q7FAZ3|LERK1_ORYSJ G-type lectin S-receptor-like serine/threonine-protein kinase LECRK137.100%Swiss-ProtMedium
A0A075F7E9Oryza sativa subsp. indicasp|A0A075F7E9|LERK1_ORYSI G-type lectin S-receptor-like serine/threonine-protein kinase LECRK136.900%Swiss-ProtMedium
Q0JEU6Oryza sativa subsp. japonicasp|Q0JEU6|LERK3_ORYSJ G-type lectin S-receptor-like serine/threonine-protein kinase LECRK336.700%Swiss-ProtMedium
Q25AG3Oryza sativa subsp. indicasp|Q25AG3|LERK3_ORYSI G-type lectin S-receptor-like serine/threonine-protein kinase LECRK336.600%Swiss-ProtMedium
Q25AG2Oryza sativa subsp. indicasp|Q25AG2|LERK4_ORYSI G-type lectin S-receptor-like serine/threonine-protein kinase LECRK437.100%Swiss-ProtMedium

JBrowse

View in Genome Browser