TkA07G354230 | RubberDandelionOmics

Gene overview

TkA07G354230

Reference: TK1151 Chr: Chr07 Coordinates: 88608003-88608866 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

864 bp · TkA07G354230|TK1151|cDNA

ATGATGCCCCAAGGATACCTTTCGGCTTTCCCGATAATTGGGTCTTCCGATGATACTTATAGCAGATACTGGTCAACTGACACGTTATCTACGGATACAGAGTCGTTATACCTCAGCCCTAATGGGTCTCTGATTTTGGTGCAGTATAATGGTACAAGGATGGTGGTGAATAAACCAACGAGCTCAGAGTCGGGAATGGATTATGAAGCTGTGATCTTCCGTGCTACTCTCGATTGGGATGGTAACTTTGTTTTGTATTC...

CDS

Download CDS FASTA

864 bp · TkA07G354230|TK1151|CDS

ATGATGCCCCAAGGATACCTTTCGGCTTTCCCGATAATTGGGTCTTCCGATGATACTTATAGCAGATACTGGTCAACTGACACGTTATCTACGGATACAGAGTCGTTATACCTCAGCCCTAATGGGTCTCTGATTTTGGTGCAGTATAATGGTACAAGGATGGTGGTGAATAAACCAACGAGCTCAGAGTCGGGAATGGATTATGAAGCTGTGATCTTCCGTGCTACTCTCGATTGGGATGGTAACTTTGTTTTGTATTC...

Protein

Download Protein FASTA

287 aa · TkA07G354230|TK1151|PROTEIN

MMPQGYLSAFPIIGSSDDTYSRYWSTDTLSTDTESLYLSPNGSLILVQYNGTRMVVNKPTSSESGMDYEAVIFRATLDWDGNFVLYSHRFTNSSSVMKIEWKALQDPCQAKGICGFNSYCTSIDGEFQCHCLPGFVDLNDTRDVKYYGCYRNFTDEEACNRKGLELSYNVTELDNMDLLAYKSYSVMKLSKDDCRRSCFDDCNCWASLYYGDGNCKKLKVPIIFAVLNTTITSTVYVKTSFPKDEVKYGITPLPESTNLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G354230`
TK1151 ID	TkA07G354230
OH-1004 ID	LXL04_029855
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.900
Protein coverage (%)	TK1151 97.909 / OH-1004 36.684 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G354230`
Location	Chr07:88608003-88608866 (+)
Description	Similar to LECRK1: G-type lectin S-receptor-like serine/threonine-protein kinase LECRK1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029855` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006952 defense response Biological Process GO:0051707 response to other organism Biological Process GO:0016020 membrane Cellular Component GO:0004672 protein kinase activity Molecular Function GO:0004674 protein serine/threonine kinase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0030246 carbohydrate binding Molecular Function GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference	dosa:Os04g0201900 dosa:Os04g0202500 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.608

Rank 1 · TkA07G354230 · TK1151

Extracellular0.210

Rank 2 · TkA07G354230 · TK1151

Endoplasmic reticulum0.086

Rank 3 · TkA07G354230 · TK1151

Cytoplasm0.081

Rank 4 · TkA07G354230 · TK1151

Lysosome / Vacuole0.034

Rank 5 · TkA07G354230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453B_lectin29-108 aa

PF00954S_locus_glycop30-50 aa

PF00954S_locus_glycop70-136 aa

PF01683EB102-140 aa

PF00008EGF105-136 aa

PF12947EGF_3111-136 aa

PF25478EGF_Mua-3113-142 aa

PF08276PAN_2114-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G354230	`PF01453`	B_lectin	29	108	0.25	12.5
TkA07G354230	`PF00954`	S_locus_glycop	30	50	9e-06	26.9
TkA07G354230	`PF00954`	S_locus_glycop	70	136	9e-06	26.9
TkA07G354230	`PF01683`	EB	102	140	0.078	13.8
TkA07G354230	`PF00008`	EGF	105	136	0.025	15.6
TkA07G354230	`PF12947`	EGF_3	111	136	0.0053	17.7
TkA07G354230	`PF25478`	EGF_Mua-3	113	142	0.045	14.5
TkA07G354230	`PF08276`	PAN_2	114	122	0.0029	18.4
TkA07G354230	`PF08276`	PAN_2	153	162	0.0029	18.4
TkA07G354230	`PF08276`	PAN_2	171	206	0.0029	18.4
TkA07G354230	`PF08277`	PAN_3	181	216	0.0089	16.6
TkA07G354230	`PF01683`	EB	197	210	0.078	13.8
TkA07G354230	`PF12947`	EGF_3	202	214	0.0053	17.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card