TkA07G350610 | RubberDandelionOmics

Gene overview

TkA07G350610

Reference: TK1151 Chr: Chr07 Coordinates: 87600053-87601925 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1016 bp · TkA07G350610|TK1151|cDNA

AAACCATGGATCTTCAATCTCGAGCATTGGCAAACGATTTTGCAATCGATCATTCAGTGATACAAAATCCTATTTATTACCCTCTCGATTGCAATTCCAGAGTATCCGAACTCTCCTCCTTCAGTCCGCTTCGGAATCCGTCAAAATTCAAAGACTTTCCGATGCCGATTCGGGAATTATTAAAATCAACATGGATAGACCCGAAGCTAAAAATGCCCTTGGGAAGGAATTTCTGAAAGGACTTCAAAATAGCTTTGAAG...

CDS

Download CDS FASTA

375 bp · TkA07G350610|TK1151|CDS

ATGAATGTACCTGAAGTTCGAGCTTTTGTTAACTCACTGAGGTCAACATTTTCATTCTTAGAGGCGCTTCAAATCCCAACTATTGCAGTAATAGAAGGTGCAGCATTAGGTGGAGGACTGGAAATGGCCTTATCTTGTGACCTCCGAATATGCGGAGAAGATGCTAAGTTGGGCTTACCAGAAACCGGGCTTGCAGTAATACCAGCGGCGGGAGGGTCACAACGGCTTCCTAGGTTAATTGGAAGCTCAAGAGCCAAAGA...

Protein

Download Protein FASTA

124 aa · TkA07G350610|TK1151|PROTEIN

MNVPEVRAFVNSLRSTFSFLEALQIPTIAVIEGAALGGGLEMALSCDLRICGEDAKLGLPETGLAVIPAAGGSQRLPRLIGSSRAKELIFTGRKISAKEALSFGLINYCVPAGNAYSKALENRS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G350610`
TK1151 ID	TkA07G350610
OH-1004 ID	LXL04_029822
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.581 / OH-1004 36.778 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G350610

Location Chr07:87600053-87601925 (-)

Description Similar to At4g16800: Probable enoyl-CoA hydratase 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16800`	Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029822 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006552 L-leucine catabolic process Biological Process

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0009083 branched-chain amino acid catabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003730 mRNA 3'-UTR binding Molecular Function

GO:0004300 enoyl-CoA hydratase activity Molecular Function

GO:0004490 methylglutaconyl-CoA hydratase activity Molecular Function

GO:0008233 peptidase activity Molecular Function

GO:0016836 hydro-lyase activity Molecular Function

KEGG gene cross-reference

ath:AT4G16800

bsu:BSU18220

ddi:DDB_G0289471

hsa:55268

mmu:52430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.305

Rank 1 · TkA07G350610 · TK1151

Peroxisome0.226

Rank 2 · TkA07G350610 · TK1151

Plastid0.204

Rank 3 · TkA07G350610 · TK1151

Cytoplasm0.178

Rank 4 · TkA07G350610 · TK1151

Nucleus0.061

Rank 5 · TkA07G350610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00378ECH_113-121 aa

PF16113ECH_214-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G350610	`PF00378`	ECH_1	13	121	1.1e-28	101.0
TkA07G350610	`PF16113`	ECH_2	14	114	6.5e-16	59.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JML5`	Arabidopsis thaliana	sp\|F4JML5\|ECH2M_ARATH Probable enoyl-CoA hydratase 2, mitochondrial	71.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card