TkA07G343450 | RubberDandelionOmics

Gene overview

TkA07G343450

Reference: TK1151 Chr: Chr07 Coordinates: 85736376-85740096 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2158 bp · TkA07G343450|TK1151|cDNA

AAAAAAATTTAATGGCAGATTACCTAGGCACTTTAGCCAATTGTTTAAGAGGTCAGCCACTGCCACAAGCAGCATGGATAGCATTATAGCAAGCTCACTCAATCCGCGCACCAAATGGCTACGGCGGCGTTGTCGCCGGCCACGGTTTGTCTCCGACTTAAACCTCTCTCTTCCACCGTTCGCTTCCTGTCCTTGTACCGCCACCACCAACCAAAACCTACCAAACTGAAATACCAAATCAGCATCGCTCCTCTTCATCA...

CDS

Download CDS FASTA

1737 bp · TkA07G343450|TK1151|CDS

ATGGCTACGGCGGCGTTGTCGCCGGCCACGGTTTGTCTCCGACTTAAACCTCTCTCTTCCACCGTTCGCTTCCTGTCCTTGTACCGCCACCACCAACCAAAACCTACCAAACTGAAATACCAAATCAGCATCGCTCCTCTTCATCACCCGCCACAACCCCGCGTCCACTTTAACTACTCAAACAACTCCACAACTAACCATCGATGCTTTTCAACCGTCGTATCCGCCACTGTATCACCCGGAGAGGTCTCAGAGAAGTC...

Protein

Download Protein FASTA

578 aa · TkA07G343450|TK1151|PROTEIN

MATAALSPATVCLRLKPLSSTVRFLSLYRHHQPKPTKLKYQISIAPLHHPPQPRVHFNYSNNSTTNHRCFSTVVSATVSPGEVSEKSSTESIGERVGEFRKRLTIVDIKGGEGEGVDRLGQTLTVEGWVRTVRIQSSVTFIEVNDGSCVSNMQCVIGPDAKGYDQVESGSITTGASVCVQGVVVPSQGKKQKIELKIGKLVLVGKSPSSFPIQKKKVTREFLRGEAHLRVRTNTFGAVSRVRSALYQATHKFFQENGFVW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G343450`
TK1151 ID	TkA07G343450
OH-1004 ID	LXL04_029750
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G343450

Location Chr07:85736376-85740096 (+)

Description Similar to SYNO: Asparagine--tRNA ligase, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17300`	Asparagine--tRNA ligase, chloroplastic/mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029750 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006421 asparaginyl-tRNA aminoacylation Biological Process

GO:0048481 plant ovule development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0004816 asparagine-tRNA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016740 transferase activity Molecular Function

GO:0140096 catalytic activity, acting on a protein Molecular Function

KEGG gene cross-reference

ana:alr3658

ath:AT4G17300

cbf:CLI_0677

mar:MAE_04410

pcu:PC_RS01700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.913

Rank 1 · TkA07G343450 · TK1151

Mitochondrion0.146

Rank 2 · TkA07G343450 · TK1151

Cytoplasm0.033

Rank 3 · TkA07G343450 · TK1151

Nucleus0.023

Rank 4 · TkA07G343450 · TK1151

Peroxisome0.013

Rank 5 · TkA07G343450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00152tRNA-synt_2110-133 aa

PF01336tRNA_anti-codon124-201 aa

PF00152tRNA-synt_2225-571 aa

PF01409tRNA-synt_2d339-362 aa

PF01409tRNA-synt_2d541-565 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G343450	`PF00152`	tRNA-synt_2	110	133	2.3e-64	218.1
TkA07G343450	`PF01336`	tRNA_anti-codon	124	201	2.4e-09	37.7
TkA07G343450	`PF00152`	tRNA-synt_2	225	571	2.3e-64	218.1
TkA07G343450	`PF01409`	tRNA-synt_2d	339	362	0.054	13.7
TkA07G343450	`PF01409`	tRNA-synt_2d	541	565	0.054	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48593`	Arabidopsis thaliana	sp\|O48593\|SYNO_ARATH Asparagine--tRNA ligase, chloroplastic/mitochondrial	71.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card