RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G342490
Reference: TK1151 Chr: Chr07 Coordinates: 85485878-85488038 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

726 bp · TkA07G342490|TK1151|cDNA

ATGGTCGCCTGGTCGGGAGTCCAAAAGAACAAAGGGCAGTCTGATTCACCCAACCAGTTCCACCATCGCCTGATCCTCCATCGCAATTTCATTCCTTTCTGGCTGCTGCATCTCGATCAGATGATCAAGCATTCGCGGGAGTCCAAGAAGGGAAGAAGATTCGAGCAGCGGAGTCATCGTCGATTGATCAGACGCAAAAACTCGGCAAATCGGCAATCGCAATTCCGCCAATTCGCAACTCGTGTTCCTGATTCGTTGTA...

CDS

Download CDS FASTA

726 bp · TkA07G342490|TK1151|CDS

ATGGTCGCCTGGTCGGGAGTCCAAAAGAACAAAGGGCAGTCTGATTCACCCAACCAGTTCCACCATCGCCTGATCCTCCATCGCAATTTCATTCCTTTCTGGCTGCTGCATCTCGATCAGATGATCAAGCATTCGCGGGAGTCCAAGAAGGGAAGAAGATTCGAGCAGCGGAGTCATCGTCGATTGATCAGACGCAAAAACTCGGCAAATCGGCAATCGCAATTCCGCCAATTCGCAACTCGTGTTCCTGATTCGTTGTA...

Protein

Download Protein FASTA

241 aa · TkA07G342490|TK1151|PROTEIN

MVAWSGVQKNKGQSDSPNQFHHRLILHRNFIPFWLLHLDQMIKHSRESKKGRRFEQRSHRRLIRRKNSANRQSQFRQFATRVPDSLYRFQVPDFLFLIPQSDQREEMLSSQQLPCVHHPGLCTNGRFQNGASLFAVRAEQISAPSTSLKGPFFRLVPGIRILGNAPTGNWFSDVSYVPPLTTKLLPRVRVYSEEKTYPQHHAPSFPNKKMPSGLHALDGPQILVASREKIPHECSSQESNS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G342490
TK1151 IDTkA07G342490
OH-1004 IDLXL04_030573
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)72.400
Protein coverage (%)TK1151 22.822 / OH-1004 25.217
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G342490
LocationChr07:85485878-85488038 (-)
DescriptionSimilar to PPL1: PsbP-like protein 1, chloroplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_030573 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0015979 photosynthesis Biological Process
GO:0048564 photosystem I assembly Biological Process
GO:0005829 cytosol Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009535 chloroplast thylakoid membrane Cellular Component
GO:0009543 chloroplast thylakoid lumen Cellular Component
GO:0009579 thylakoid Cellular Component
GO:0009654 photosystem II oxygen evolving complex Cellular Component
GO:0019898 extrinsic component of membrane Cellular Component
GO:0031977 thylakoid lumen Cellular Component
GO:0042651 thylakoid membrane Cellular Component
GO:0098807 chloroplast thylakoid membrane protein complex Cellular Component
KEGG gene cross-reference
ath:AT2G39470
ath:AT3G05410
ath:AT3G55330
syn:sll1418
tel:tlr2075
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.433
Rank 1 · TkA07G342490 · TK1151
Nucleus0.407
Rank 2 · TkA07G342490 · TK1151
Mitochondrion0.192
Rank 3 · TkA07G342490 · TK1151
Cell membrane0.073
Rank 4 · TkA07G342490 · TK1151
Endoplasmic reticulum0.046
Rank 5 · TkA07G342490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser