TkA07G340660 | RubberDandelionOmics

Gene overview

TkA07G340660

Reference: TK1151 Chr: Chr07 Coordinates: 85068567-85068911 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

345 bp · TkA07G340660|TK1151|cDNA

ATGGCTTGCATCAATATGACGTGCTGCTGTCTTGGCTTACAAGAAGGGCTTGAAGTTGATCCCAATAATGAAACGTTGAAATCCGGACTAGCGTCCGCTCAGTCAGATCAGGCGGCTGCGTCAGCCTCTTCTCGGTCACGCGCACCGCCAAATAACCTGTTTGGAGATGCGTTTGGTCCGGATATGTGGGCGAAGCTTACGGCTGATCCGGCTACACGATTGTATATGCAACAGCCGGATTTTGTTAACATGATGAAGGA...

CDS

Download CDS FASTA

345 bp · TkA07G340660|TK1151|CDS

ATGGCTTGCATCAATATGACGTGCTGCTGTCTTGGCTTACAAGAAGGGCTTGAAGTTGATCCCAATAATGAAACGTTGAAATCCGGACTAGCGTCCGCTCAGTCAGATCAGGCGGCTGCGTCAGCCTCTTCTCGGTCACGCGCACCGCCAAATAACCTGTTTGGAGATGCGTTTGGTCCGGATATGTGGGCGAAGCTTACGGCTGATCCGGCTACACGATTGTATATGCAACAGCCGGATTTTGTTAACATGATGAAGGA...

Protein

Download Protein FASTA

114 aa · TkA07G340660|TK1151|PROTEIN

MACINMTCCCLGLQEGLEVDPNNETLKSGLASAQSDQAAASASSRSRAPPNNLFGDAFGPDMWAKLTADPATRLYMQQPDFVNMMKDLQKNPSNLNLYLKDQRELCKPLVLLKR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G340660`
TK1151 ID	TkA07G340660
OH-1004 ID	LXL04_029720
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.400
Protein coverage (%)	TK1151 79.825 / OH-1004 15.294 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G340660

Location Chr07:85068567-85068911 (+)

Description Similar to HOP2: Hsp70-Hsp90 organizing protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12270`	Mediates the association of the molecular chaperones HSP70 and HSP90.	No verified direct reference in this release
`At1g62740`	Mediates the association of the molecular chaperones HSP70 and HSP90.	No verified direct reference in this release
`At4g12400`	Mediates the association of the molecular chaperones HSP70 and HSP90.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029720 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006986 response to unfolded protein Biological Process

GO:0009408 response to heat Biological Process

GO:0009611 response to wounding Biological Process

GO:0010286 heat acclimation Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0051131 chaperone-mediated protein complex assembly Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0051879 Hsp90 protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G62740

ath:AT4G12400

gmx:547932

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.483

Rank 1 · TkA07G340660 · TK1151

Nucleus0.269

Rank 2 · TkA07G340660 · TK1151

Peroxisome0.241

Rank 3 · TkA07G340660 · TK1151

Mitochondrion0.136

Rank 4 · TkA07G340660 · TK1151

Extracellular0.081

Rank 5 · TkA07G340660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16664STAC2_u116-53 aa

PF17830STI1-HOP_DP59-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G340660	`PF16664`	STAC2_u1	16	53	0.14	13.2
TkA07G340660	`PF17830`	STI1-HOP_DP	59	103	3.5e-17	62.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNB6`	Arabidopsis thaliana	sp\|Q9LNB6\|HSOP1_ARATH Hsp70-Hsp90 organizing protein 1	63.000%	Swiss-Prot	High
`Q5XEP2`	Arabidopsis thaliana	sp\|Q5XEP2\|HSOP2_ARATH Hsp70-Hsp90 organizing protein 2	62.800%	Swiss-Prot	High
`Q9STH1`	Arabidopsis thaliana	sp\|Q9STH1\|HSOP3_ARATH Hsp70-Hsp90 organizing protein 3	54.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card