TkA07G337220 | RubberDandelionOmics

Gene overview

TkA07G337220

Reference: TK1151 Chr: Chr07 Coordinates: 84236849-84239048 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1375 bp · TkA07G337220|TK1151|cDNA

TTAGCATGAAACTCTTAGGACGCAACTGCAATTCCGCGATAAAGATACCACCAAATCATGCCTTCGAATCCACGTTCCCTTTCAATTCCCTACCTTTTCTCCTTCACAATAACACATTCCATTTGATTCTTCCGGATTTCTCTCATTACTTTCTTTCGATCGACATATTCATACGGCTACTCCAAACCCTCCGATTTAGGGTTGTTTTTATTCGATTCGATTCGATTTTGATTTGATATCATTATCAATCGGAATGTCGC...

CDS

Download CDS FASTA

912 bp · TkA07G337220|TK1151|CDS

ATGTCGCATGAAAACAATGCTGGAGTCGCCCGGTTGAAGGTCGGGTTTGATGACCACAAGCCTGATTATGTAATCATGGCGGAACCGGAAGGATTTGATGACGACCGCGGCAGCGCCGTTGTGGCTCCGTCGCCTCCATCTCCGTCCGGGGACTGTACTAGTATATGGTGGTCATTTTGGTGGTGGGGAAAACTTGTTTTTCTTGTCATATTCTTAGCTGTTTTAGGGATTTGTTTCTTCGCATGGATCGGACCCTTCCT...

Protein

Download Protein FASTA

303 aa · TkA07G337220|TK1151|PROTEIN

MSHENNAGVARLKVGFDDHKPDYVIMAEPEGFDDDRGSAVVAPSPPSPSGDCTSIWWSFWWWGKLVFLVIFLAVLGICFFAWIGPFLMDKEVIPILNWETETFSKPVLAVMIFGSVALFPCLFIPSTPSMWVAGMSFGYGLGFLLIISGVTIGVSLPYFFGSLFYRKIQGWLERYPKKASIIRLAGEGDWYDQFRAVMLLRISPFPYAVYNYCAVATDVKFVPYLFGTLVGMVPEIFVAIYTGIMIRTLADASQEQRSLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G337220`
TK1151 ID	TkA07G337220
OH-1004 ID	LXL04_005824
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	65.700
Protein coverage (%)	TK1151 99.340 / OH-1004 99.677 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G337220`
Location	Chr07:84236849-84239048 (-)
Description	Similar to slr0305: TVP38/TMEM64 family membrane protein slr0305 (Synechocystis sp. (strain PCC 6803 / Kazusa)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005824` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0043462 regulation of ATP-dependent activity Biological Process GO:0051480 regulation of cytosolic calcium ion concentration Biological Process GO:0090090 negative regulation of canonical Wnt signaling pathway Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component
KEGG gene cross-reference	hsa:169200 mmu:100201 syn:slr0305 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.338

Rank 1 · TkA07G337220 · TK1151

Endoplasmic reticulum0.213

Rank 2 · TkA07G337220 · TK1151

Cell membrane0.203

Rank 3 · TkA07G337220 · TK1151

Golgi apparatus0.177

Rank 4 · TkA07G337220 · TK1151

Cytoplasm0.138

Rank 5 · TkA07G337220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06726BC1070-76 aa

PF14937DUF4500100-122 aa

PF09335VTT_dom107-122 aa

PF06726BC10118-137 aa

PF09335VTT_dom124-244 aa

PF06726BC10214-249 aa

PF12304BCLP229-288 aa

PF09335VTT_dom266-281 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G337220	`PF06726`	BC10	70	76	2.9	8.9
TkA07G337220	`PF14937`	DUF4500	100	122	0.27	11.9
TkA07G337220	`PF09335`	VTT_dom	107	122	7.7e-18	65.9
TkA07G337220	`PF06726`	BC10	118	137	2.9	8.9
TkA07G337220	`PF09335`	VTT_dom	124	244	7.7e-18	65.9
TkA07G337220	`PF06726`	BC10	214	249	2.9	8.9
TkA07G337220	`PF12304`	BCLP	229	288	0.12	12.7
TkA07G337220	`PF09335`	VTT_dom	266	281	7.7e-18	65.9
TkA07G337220	`PF14880`	COX14	266	299	0.13	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card