TkA07G336880 | RubberDandelionOmics

Gene overview

TkA07G336880

Reference: TK1151 Chr: Chr07 Coordinates: 84157705-84159927 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2187 bp · TkA07G336880|TK1151|cDNA

ATGCGATGGGTGGCGCTCATACCGCTTCTCGCTTTTTCGACCCTTACCCTTTTAACCTTCTATTCAGCAAACGCTGCCGAGCTTGAAACGTACATTGTGCACTTAACCTCACCTAAAGCTCAAGAATCTTTTAAAAAGGAAGATCGCCAAAGCTGGTACAACTCGTTTTTGCCGCAAACCACTACACTTTCAAATGACGAACCAAGCATGGTTTTTGCATACCATAATGTGCTTACAGGGTTCGCAGCAAAACTATCTGT...

CDS

Download CDS FASTA

2187 bp · TkA07G336880|TK1151|CDS

ATGCGATGGGTGGCGCTCATACCGCTTCTCGCTTTTTCGACCCTTACCCTTTTAACCTTCTATTCAGCAAACGCTGCCGAGCTTGAAACGTACATTGTGCACTTAACCTCACCTAAAGCTCAAGAATCTTTTAAAAAGGAAGATCGCCAAAGCTGGTACAACTCGTTTTTGCCGCAAACCACTACACTTTCAAATGACGAACCAAGCATGGTTTTTGCATACCATAATGTGCTTACAGGGTTCGCAGCAAAACTATCTGT...

Protein

Download Protein FASTA

728 aa · TkA07G336880|TK1151|PROTEIN

MRWVALIPLLAFSTLTLLTFYSANAAELETYIVHLTSPKAQESFKKEDRQSWYNSFLPQTTTLSNDEPSMVFAYHNVLTGFAAKLSVEQAKAMEGMDGFVSARPQRFYKTQTTHTPNFLGLHQNTGFWASSNYGKGVIIGVLDTGTTPGHPSFDDKGVSPPPAKWKGKCEIGGCNNKLIGLRDLTTGGNDTRYDQDGHGTHTSSTAAGNFVNDANVFGNAQGTAVGMAPLAHVAMYKVCTLEDCTESAILAGMDAAVEDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G336880`
TK1151 ID	TkA07G336880
OH-1004 ID	LXL04_029694
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 85.847 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G336880`
Location	Chr07:84157705-84159927 (-)
Description	Similar to SBT: Subtilisin-like protease
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029694` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0009609 response to symbiotic bacterium Biological Process GO:0009610 response to symbiotic fungus Biological Process GO:0036377 arbuscular mycorrhizal association Biological Process GO:0005576 extracellular region Cellular Component GO:0005615 extracellular space Cellular Component GO:0048046 apoplast Cellular Component GO:0004252 serine-type endopeptidase activity Molecular Function
KEGG gene cross-reference	mtr:11443095 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.655

Rank 1 · TkA07G336880 · TK1151

Lysosome / Vacuole0.114

Rank 2 · TkA07G336880 · TK1151

Cell membrane0.094

Rank 3 · TkA07G336880 · TK1151

Cytoplasm0.072

Rank 4 · TkA07G336880 · TK1151

Endoplasmic reticulum0.057

Rank 5 · TkA07G336880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05922Inhibitor_I930-110 aa

PF00082Peptidase_S8134-548 aa

PF02225PA356-429 aa

PF17766fn3_6624-725 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G336880	`PF05922`	Inhibitor_I9	30	110	3e-11	44.6
TkA07G336880	`PF00082`	Peptidase_S8	134	548	1.4e-45	156.5
TkA07G336880	`PF02225`	PA	356	429	6.6e-13	49.3
TkA07G336880	`PF17766`	fn3_6	624	725	1.5e-19	70.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card