TkA07G332320 | RubberDandelionOmics

Gene overview

TkA07G332320

Reference: TK1151 Chr: Chr07 Coordinates: 83084450-83086767 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1322 bp · TkA07G332320|TK1151|cDNA

AAAAAAGTTAACTCCCTCGCTTAAACGTAAATTACAGAAGTACCCTTCAATTCAAACAACCCCTTGACGGTTGGATCAGCGCACATTCTCAATTTCTACCGACTTTCCCAATCTCAGTTCATCCACCTTTCAGTCTTTCAGTTTCACCGTAAAATTAGCAACACAAACCACCGTCAACCGTCGGAAACACCATCAAATCTCCTGCAAAATGAGCTCAATTGAGCGCCCGGAGGGGCTTCCCTCCACCTGGACTGTAGAAA...

CDS

Download CDS FASTA

726 bp · TkA07G332320|TK1151|CDS

ATGCTGGAGGTTTCCGACTATCTAAACACTACCAACATCAACAAAGCCACTGAGAAAACAGGAGAGAATACCCCTTCAGAAACAGGTAACCCCCAGAACTCTGAATCCGCTGATGTGGCAGAAGACACTTCTGAAAAGAAGCAAGAAAGCAATGAGAAGAATGCTATCTCGGGGACTCAAGTGGATGGGCTACCCGAAGGTTGGATAAAAGAAGTGGTAGTTAGGCGTGCTAAAGGCGGTACAAGAAAAGATTCGTACTA...

Protein

Download Protein FASTA

241 aa · TkA07G332320|TK1151|PROTEIN

MLEVSDYLNTTNINKATEKTGENTPSETGNPQNSESADVAEDTSEKKQESNEKNAISGTQVDGLPEGWIKEVVVRRAKGGTRKDSYYLDPSSDYAFLSKLDALRYLETGVIDKCAIKPKKKSEILMKSVETPTKSKSVGRKSRKKSTSSSTSGCSKRFKTSETVEPEKEEKVEGSVAMDDNTEEVKDNVEKSTNDEKTEVPLVSEPVKSVNGDVPTEVPEIPLSVGIEERKNEVVNEVTNL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G332320`
TK1151 ID	TkA07G332320
OH-1004 ID	LXL04_029634
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.000
Protein coverage (%)	TK1151 100.000 / OH-1004 85.560 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G332320`
Location	Chr07:83084450-83086767 (-)
Description	Similar to MBD13: Methyl-CpG-binding domain-containing protein 13
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029634` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0005634 nucleus Cellular Component GO:0008327 methyl-CpG binding Molecular Function
KEGG gene cross-reference	ath:AT5G52230 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · TkA07G332320 · TK1151

Cytoplasm0.083

Rank 2 · TkA07G332320 · TK1151

Cell membrane0.020

Rank 3 · TkA07G332320 · TK1151

Endoplasmic reticulum0.011

Rank 4 · TkA07G332320 · TK1151

Mitochondrion0.008

Rank 5 · TkA07G332320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17233DUF530818-52 aa

PF12235FXMRP1_C_core24-54 aa

PF07800DUF164432-49 aa

PF01429MBD64-110 aa

PF17233DUF530895-187 aa

PF12235FXMRP1_C_core128-187 aa

PF07800DUF1644139-208 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G332320	`PF17233`	DUF5308	18	52	0.12	13.4
TkA07G332320	`PF12235`	FXMRP1_C_core	24	54	0.37	12.3
TkA07G332320	`PF07800`	DUF1644	32	49	0.74	10.6
TkA07G332320	`PF01429`	MBD	64	110	0.0038	17.5
TkA07G332320	`PF17233`	DUF5308	95	187	0.12	13.4
TkA07G332320	`PF12235`	FXMRP1_C_core	128	187	0.37	12.3
TkA07G332320	`PF07800`	DUF1644	139	208	0.74	10.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card