TkA07G328860 | RubberDandelionOmics

Gene overview

TkA07G328860

Reference: TK1151 Chr: Chr07 Coordinates: 82248893-82249328 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

366 bp · TkA07G328860|TK1151|cDNA

ATGTCCTTCACCGACGTCGTCAGCAGTCTAGAAAAACACGACATCGCTAGAATATTCTCCGCACTTCTCCAACTGATAATCAATCAATCAATCGTGAATAACGAAAACGTTGAACTGGAAAGAGGCGGGATTGAAGGTGGACATGTTTGTTACACCGGCGAGAATCCGTTCCATGTGCGTCTTCTTACGAATGTGAAACGACCGGAAGTACGACTCCGATCTGCTAATAAGAGACCAAAGGGTCAGAAGAGAGGAAAAGA...

CDS

Download CDS FASTA

366 bp · TkA07G328860|TK1151|CDS

ATGTCCTTCACCGACGTCGTCAGCAGTCTAGAAAAACACGACATCGCTAGAATATTCTCCGCACTTCTCCAACTGATAATCAATCAATCAATCGTGAATAACGAAAACGTTGAACTGGAAAGAGGCGGGATTGAAGGTGGACATGTTTGTTACACCGGCGAGAATCCGTTCCATGTGCGTCTTCTTACGAATGTGAAACGACCGGAAGTACGACTCCGATCTGCTAATAAGAGACCAAAGGGTCAGAAGAGAGGAAAAGA...

Protein

Download Protein FASTA

121 aa · TkA07G328860|TK1151|PROTEIN

MSFTDVVSSLEKHDIARIFSALLQLIINQSIVNNENVELERGGIEGGHVCYTGENPFHVRLLTNVKRPEVRLRSANKRPKGQKRGKENLSPGSVSPPRSIKVRKIGGIKCTPESKTRRLKW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G328860`
TK1151 ID	TkA07G328860
OH-1004 ID	LXL04_022529
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.400
Protein coverage (%)	TK1151 97.521 / OH-1004 8.868 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G328860

Location Chr07:82248893-82249328 (+)

Description Similar to CAPH2: Condensin-2 complex subunit H2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16730`	Regulatory subunit of the condensin-2 complex, a complex that seems to provide chromosomes with an additional level of organization and rigidity and in establishing mitotic chromosome architecture (By similarity).	Condensin II alleviates DNA damage and is essential for tolerance of boron overload stress in Arabidopsis.2011 · DOI: 10.1105/tpc.111.086314

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022529 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006974 DNA damage response Biological Process

GO:0010032 meiotic chromosome condensation Biological Process

GO:0042545 cell wall modification Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0045739 positive regulation of DNA repair Biological Process

GO:0048358 mucilage pectin biosynthetic process Biological Process

GO:0051306 mitotic sister chromatid separation Biological Process

GO:0000793 condensed chromosome Cellular Component

GO:0000796 condensin complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT3G05610

ath:AT3G06830

ath:AT3G16730

ath:AT5G27870

ath:AT5G49180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.948

Rank 1 · TkA07G328860 · TK1151

Cytoplasm0.169

Rank 2 · TkA07G328860 · TK1151

Mitochondrion0.017

Rank 3 · TkA07G328860 · TK1151

Cell membrane0.016

Rank 4 · TkA07G328860 · TK1151

Endoplasmic reticulum0.007

Rank 5 · TkA07G328860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16858CNDH2_C2-67 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G328860	`PF16858`	CNDH2_C	2	67	6e-07	30.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUR0`	Arabidopsis thaliana	sp\|Q9LUR0\|CNDH2_ARATH Condensin-2 complex subunit H2	39.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card