TkA07G316680 | RubberDandelionOmics

Gene overview

TkA07G316680

Reference: TK1151 Chr: Chr07 Coordinates: 79366338-79372391 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1823 bp · TkA07G316680|TK1151|cDNA

GTGGTATTTCGTATTCATTAATTAATCTGTACGCATATATGCATCCATATAAATCATGTTCTTGTCCTTGCTGCTTTTCTGTTATCATTATCTCTTTCGTGGATGCCTAAAGAAGAAATGAGTTTGTCTGTGAATGTAAATGTAAATGGTCAGTCTAAAGTGCCTCCAGGGTTCCGGTTCCACCCTACGGAAGAAGAGCTTCTTCATTACTACTTGAGGAAGAAGGTTGCATATGAAAAGATCGATCTTGATGTTATTCG...

CDS

Download CDS FASTA

1248 bp · TkA07G316680|TK1151|CDS

ATGCCTAAAGAAGAAATGAGTTTGTCTGTGAATGTAAATGTAAATGGTCAGTCTAAAGTGCCTCCAGGGTTCCGGTTCCACCCTACGGAAGAAGAGCTTCTTCATTACTACTTGAGGAAGAAGGTTGCATATGAAAAGATCGATCTTGATGTTATTCGCGATGTTGACCTTAACAAGCTTGAGCCATGGGATATCCAAGAAAAGTGCAGAATTGGATCGACACCGCAAAACGATTGGTATTTCTTTAGTCATAAAGACAA...

Protein

Download Protein FASTA

415 aa · TkA07G316680|TK1151|PROTEIN

MPKEEMSLSVNVNVNGQSKVPPGFRFHPTEEELLHYYLRKKVAYEKIDLDVIRDVDLNKLEPWDIQEKCRIGSTPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVIYSSSKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRLDDHTITSQDYGSVSNLCDSAQEEGWVVCRVFKKKNYHKAVESPQRSSSAPSIDSTTQMQSLNKDGSVGDQFLVYDNGGRSCKREMDSPLLNNITISHVYNNPVQQFANPIDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G316680`
TK1151 ID	TkA07G316680
OH-1004 ID	LXL04_029446
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 99.277 / OH-1004 88.337 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G316680

Location Chr07:79366338-79372391 (-)

Description Similar to NAC043: NAC domain-containing protein 43

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46770`	Transcription activator of genes involved in the biosynthesis of secondary walls.	The NAC transcription factors NST1 and NST2 of Arabidopsis regulate secondary wall thickenings and are required for anther dehiscence.2005 · DOI: 10.1105/tpc.105.036004 NAC transcription factors, NST1 and NST3, are key regulators of the formation of secondary walls in woody tissues of Arabidopsis.2007 · DOI: 10.1105/tpc.106.047043 Two NAC domain transcription factors, SND1 and NST1, function redundantly in regulation of secondary wall synthesis in fibers of Arabidopsis.2007 · DOI: 10.1007/s00425-007-0498-y ZINC FINGER PROTEIN2 suppresses funiculus lignification to ensure seed loading efficiency in Arabidopsis.2025 · DOI: 10.1016/j.devcel.2025.01.021
`At1g32770`	Transcriptional activator of genes involved in biosynthesis of secondary walls.	SND1, a NAC domain transcription factor, is a key regulator of secondary wall synthesis in fibers of Arabidopsis.2006 · DOI: 10.1105/tpc.106.047399 NAC transcription factors, NST1 and NST3, are key regulators of the formation of secondary walls in woody tissues of Arabidopsis.2007 · DOI: 10.1105/tpc.106.047043 Two NAC domain transcription factors, SND1 and NST1, function redundantly in regulation of secondary wall synthesis in fibers of Arabidopsis.2007 · DOI: 10.1007/s00425-007-0498-y The MYB46 transcription factor is a direct target of SND1 and regulates secondary wall biosynthesis in Arabidopsis.2007 · DOI: 10.1105/tpc.107.053678
`At3g61910`	Transcription activator of genes involved in biosynthesis of secondary walls.	The NAC transcription factors NST1 and NST2 of Arabidopsis regulate secondary wall thickenings and are required for anther dehiscence.2005 · DOI: 10.1105/tpc.105.036004
`At1g79580`	Transcription regulator.	No verified direct reference in this release
`At4g10350`	Transcription activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029446 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0003002 regionalization Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010047 fruit dehiscence Biological Process

GO:0010455 positive regulation of cell fate commitment Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048829 root cap development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G32770

ath:AT1G79580

ath:AT2G46770

ath:AT3G61910

ath:AT4G10350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.955

Rank 1 · TkA07G316680 · TK1151

Cytoplasm0.107

Rank 2 · TkA07G316680 · TK1151

Cell membrane0.040

Rank 3 · TkA07G316680 · TK1151

Endoplasmic reticulum0.033

Rank 4 · TkA07G316680 · TK1151

Plastid0.014

Rank 5 · TkA07G316680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365NAM21-148 aa

PF16155PnbB149-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G316680	`PF02365`	NAM	21	148	1.4e-45	155.4
TkA07G316680	`PF16155`	PnbB	149	207	0.15	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WP6`	Arabidopsis thaliana	sp\|Q84WP6\|NAC43_ARATH NAC domain-containing protein 43	50.700%	Swiss-Prot	High
`Q9LPI7`	Arabidopsis thaliana	sp\|Q9LPI7\|NAC12_ARATH NAC domain-containing protein 12	47.600%	Swiss-Prot	Medium
`Q9M274`	Arabidopsis thaliana	sp\|Q9M274\|NAC66_ARATH NAC domain-containing protein 66	52.400%	Swiss-Prot	High
`Q9MA17`	Arabidopsis thaliana	sp\|Q9MA17\|SMB_ARATH Protein SOMBRERO	70.400%	Swiss-Prot	Low
`Q9SV87`	Arabidopsis thaliana	sp\|Q9SV87\|BRN2_ARATH Protein BEARSKIN2	42.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card