TkA07G309940 | RubberDandelionOmics

Gene overview

TkA07G309940

Reference: TK1151 Chr: Chr07 Coordinates: 77804734-77815518 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2890 bp · TkA07G309940|TK1151|cDNA

CAAAAATTTCAATAATTGTAAATTATGAAGCCAAAACGTTACATACGTGATTAAATTCCACCCACCCTAAACTAAACTTATCCATCCATAAACTAAATCTTATCCCCCTCTCTCTTTCTTTATAGCCAAACACTATCTCTCTCTAAAAAATAAGGAGACGATTTCACAACTTCAGTAACTAAAAAAACATTCGAAAAACGTGTTGCTTAGCATCATAGACTTATATCCTTTAATTCCCATACCTCAATATAAAAACACCC...

CDS

Download CDS FASTA

1254 bp · TkA07G309940|TK1151|CDS

ATGGTCACTGGCCTGCTGAAAAATGCGGGCCCACTGTATTTCATGCAGCCATTGGTTATCTGTTTATATATTACTGGTCATCTTAACATTGTTTTCCCAGAAGAATATCGAAAAGAATTCTACGTTACTTATATTGCCATCAGAATGAAGACGGTGGTTGGGGATTTCATCGAGGGTCATAGCACCATGTTTGGGACCACCCTCAGTTACATTTGTATGCGGCTCTTAGGAGAAGGTCCGGATGGTGGTCTGAATGGTGC...

Protein

Download Protein FASTA

417 aa · TkA07G309940|TK1151|PROTEIN

MVTGLLKNAGPLYFMQPLVICLYITGHLNIVFPEEYRKEFYVTYIAIRMKTVVGDFIEGHSTMFGTTLSYICMRLLGEGPDGGLNGACTKARKWILDHGSVTAIPSWGKTWLSILGVCEWAGTNPMPPEFWLLPSFLPMCPAKMWCYCRLVYMPMSYLYGKRFVGPITPLVLQLRDELYAQPYDEINWKSIRHLCAKEDLYYPHPFLQDLMWDSLYICTEPLLNRWPLNKLRQKALDTTMKHIHYEDENSHYITIGSVVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G309940`
TK1151 ID	TkA07G309940
OH-1004 ID	LXL04_029396
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.400
Protein coverage (%)	TK1151 98.561 / OH-1004 54.354 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G309940`
Location	Chr07:77804734-77815518 (-)
Description	Similar to OSCPNY2: Beta-amyrin synthase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029396` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002238 response to molecule of fungal origin Biological Process GO:0009723 response to ethylene Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0010038 response to metal ion Biological Process GO:0016104 triterpenoid biosynthetic process Biological Process GO:0019745 pentacyclic triterpenoid biosynthetic process Biological Process GO:0042542 response to hydrogen peroxide Biological Process GO:0071731 response to nitric oxide Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005811 lipid droplet Cellular Component GO:0016866 intramolecular transferase activity Molecular Function GO:0042300 beta-amyrin synthase activity Molecular Function
KEGG gene cross-reference	ag:BAA33461 ag:BAB83088 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.319

Rank 1 · TkA07G309940 · TK1151

Mitochondrion0.279

Rank 2 · TkA07G309940 · TK1151

Cytoplasm0.110

Rank 3 · TkA07G309940 · TK1151

Peroxisome0.071

Rank 4 · TkA07G309940 · TK1151

Cell membrane0.060

Rank 5 · TkA07G309940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14123DUF429034-53 aa

PF13249SQHop_cyclase_N56-268 aa

PF14123DUF4290209-272 aa

PF13243SQHop_cyclase_C304-366 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G309940	`PF14123`	DUF4290	34	53	0.071	13.4
TkA07G309940	`PF13249`	SQHop_cyclase_N	56	268	2.4e-24	86.7
TkA07G309940	`PF14123`	DUF4290	209	272	0.071	13.4
TkA07G309940	`PF13243`	SQHop_cyclase_C	304	366	6e-05	22.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card