TkA07G307230 | RubberDandelionOmics

Gene overview

TkA07G307230

Reference: TK1151 Chr: Chr07 Coordinates: 77125500-77127646 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1728 bp · TkA07G307230|TK1151|cDNA

TTATAATTGATACCTATTTATTTTATTTTTTCTATTTCTACTTGTCTTAAACTTTACTATGATAATTATTTATAAAATGTTAAAAATATCATTGTTTTATTACTAACATGAAGTATCAACTTAATCATCAACTCAGTCGTATTTAATTCAAAATTTTCTTTTTAAAATTACTTAAGTTTTAAACTTTTATATTTAATATTTAATTTTAATAAACTCGTATACACGGGACTCATAATCTATACTACATATAAAGCAAACCC...

CDS

Download CDS FASTA

564 bp · TkA07G307230|TK1151|CDS

ATGTATTTTCTTGGTTTCCCTGTCTATCGATTGGATCCACCATCTAATTCAATGGGATCTGTAAAGGATCCAGATGCTGTTTTCTTCAAAAAGCTAGACGGGTTTCAGCCATGTGAAATACACGAAATAAAAGCCGGCATGCATACATTTGCTGTTTATGGTGATAATTTCTTTAAAAGTGTGAGTTACACAATAGAATTTCTTTGCACAGAGGCTTTTGTAGAAGAAAAAGAGAGTCTGAGAGCAGTTGAAGCTCAGAT...

Protein

Download Protein FASTA

187 aa · TkA07G307230|TK1151|PROTEIN

MYFLGFPVYRLDPPSNSMGSVKDPDAVFFKKLDGFQPCEIHEIKAGMHTFAVYGDNFFKSVSYTIEFLCTEAFVEEKESLRAVEAQILSKRLELSKFRVQTGWVLAQFTEMTGRYAQEMQAIDELLTQRNEIHASYTMVSPIKHAIAGGVEVRAKGELKEDSHQKASSRERKKKKKWFNIHNSSTNS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G307230`
TK1151 ID	TkA07G307230
OH-1004 ID	LXL04_011549
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	83.700
Protein coverage (%)	TK1151 96.791 / OH-1004 38.229 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G307230

Location Chr07:77125500-77127646 (+)

Description Similar to ATJ16: Chaperone protein dnaJ 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24120`	Plays a continuous role in plant development probably in the structural organization of compartments (By similarity).	No verified direct reference in this release
`At1g68370`	Plays a continuous role in plant development probably in the structural organization of compartments (By similarity).	No verified direct reference in this release
`At1g59980`	Plays a continuous role in plant development probably in the structural organization of compartments (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011549 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009737 response to abscisic acid Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0016020 membrane Cellular Component

GO:0008092 cytoskeletal protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G24120

ath:AT1G59980

ath:AT1G68370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.447

Rank 1 · TkA07G307230 · TK1151

Nucleus0.240

Rank 2 · TkA07G307230 · TK1151

Cell membrane0.215

Rank 3 · TkA07G307230 · TK1151

Endoplasmic reticulum0.195

Rank 4 · TkA07G307230 · TK1151

Golgi apparatus0.153

Rank 5 · TkA07G307230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VXV4`	Arabidopsis thaliana	sp\|Q8VXV4\|DNJ16_ARATH Chaperone protein dnaJ 16	67.600%	Swiss-Prot	High
`Q9ZSY2`	Arabidopsis thaliana	sp\|Q9ZSY2\|DNJ15_ARATH Chaperone protein dnaJ 15	46.200%	Swiss-Prot	Medium
`Q6XL73`	Arabidopsis thaliana	sp\|Q6XL73\|DNJ39_ARATH Chaperone protein dnaJ 39	50.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card