TkA07G304810 | RubberDandelionOmics

Gene overview

TkA07G304810

Reference: TK1151 Chr: Chr07 Coordinates: 76483694-76484643 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

588 bp · TkA07G304810|TK1151|cDNA

ATGTCATCTTCCATTAGTGAATTTCAGGACCTCAAAATTCCACTTGAGTACATAAAAAAGGCCACCAACAACTTTGGAGTCGGTAACTTCATTGCCAAAGGAGGGTTTGGGGAGGTGTATAGGGGAGAATTTCTTCAATCTGACGTTCAAACCTTGGTTGCTGTAAAGCGCTTGACTCCTTCAAATAGTAATAATGGGGATGCTGATTTCTGGAGAGAAATCATGTTGCTTTCCGATTATAAACATGAAAATATCATCTT...

CDS

Download CDS FASTA

588 bp · TkA07G304810|TK1151|CDS

ATGTCATCTTCCATTAGTGAATTTCAGGACCTCAAAATTCCACTTGAGTACATAAAAAAGGCCACCAACAACTTTGGAGTCGGTAACTTCATTGCCAAAGGAGGGTTTGGGGAGGTGTATAGGGGAGAATTTCTTCAATCTGACGTTCAAACCTTGGTTGCTGTAAAGCGCTTGACTCCTTCAAATAGTAATAATGGGGATGCTGATTTCTGGAGAGAAATCATGTTGCTTTCCGATTATAAACATGAAAATATCATCTT...

Protein

Download Protein FASTA

195 aa · TkA07G304810|TK1151|PROTEIN

MSSSISEFQDLKIPLEYIKKATNNFGVGNFIAKGGFGEVYRGEFLQSDVQTLVAVKRLTPSNSNNGDADFWREIMLLSDYKHENIILLLGGQQRLLHRDIKSANILLDENWNLKIADFGFSKYVLISEPKGTLGYCDPVFLDTTFYKKESDVYSFGVVLLEVCLESEQNQRPPMELIVKKLEAALEYQVCSITLS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G304810`
TK1151 ID	TkA07G304810
OH-1004 ID	LXL04_037425
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	38.800
Protein coverage (%)	TK1151 94.359 / OH-1004 23.502 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G304810

Location Chr07:76483694-76484643 (-)

Description Similar to CPK9: Calcium-dependent protein kinase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15730`	Calcium/calmodulin-regulated receptor-like kinase 2.	No verified direct reference in this release
`At5g48740`	Probable LRR receptor-like serine/threonine-protein kinase At5g48740.	No verified direct reference in this release
`At4g00330`	Calmodulin-binding receptor-like cytoplasmic kinase 2.	No verified direct reference in this release
`At1g21230`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037425 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0009931 calcium-dependent protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G50700

ath:AT3G20410

dosa:Os07g0515100

osa:4343373

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.648

Rank 1 · TkA07G304810 · TK1151

Nucleus0.329

Rank 2 · TkA07G304810 · TK1151

Cell membrane0.122

Rank 3 · TkA07G304810 · TK1151

Endoplasmic reticulum0.076

Rank 4 · TkA07G304810 · TK1151

Mitochondrion0.061

Rank 5 · TkA07G304810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr29-90 aa

PF00069Pkinase29-89 aa

PF03109ABC131-70 aa

PF01636APH67-121 aa

PF07914DUF167980-112 aa

PF07714PK_Tyr_Ser-Thr92-169 aa

PF00069Pkinase93-167 aa

PF03109ABC193-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G304810	`PF07714`	PK_Tyr_Ser-Thr	29	90	6.3e-26	91.9
TkA07G304810	`PF00069`	Pkinase	29	89	3.7e-25	89.5
TkA07G304810	`PF03109`	ABC1	31	70	0.015	15.2
TkA07G304810	`PF01636`	APH	67	121	0.025	15.1
TkA07G304810	`PF07914`	DUF1679	80	112	0.21	11.2
TkA07G304810	`PF07714`	PK_Tyr_Ser-Thr	92	169	6.3e-26	91.9
TkA07G304810	`PF00069`	Pkinase	93	167	3.7e-25	89.5
TkA07G304810	`PF03109`	ABC1	93	123	0.015	15.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFV3`	Arabidopsis thaliana	sp\|Q9LFV3\|CRLK2_ARATH Calcium/calmodulin-regulated receptor-like kinase 2	44.300%	Swiss-Prot	Low
`C0LGV0`	Arabidopsis thaliana	sp\|C0LGV0\|Y5487_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g48740	46.200%	Swiss-Prot	Low
`Q8VZJ9`	Arabidopsis thaliana	sp\|Q8VZJ9\|CRCK2_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 2	39.300%	Swiss-Prot	Medium
`Q9LMN7`	Arabidopsis thaliana	sp\|Q9LMN7\|WAK5_ARATH Wall-associated receptor kinase 5	41.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card