TkA07G289880 | RubberDandelionOmics

Gene overview

TkA07G289880

Reference: TK1151 Chr: Chr07 Coordinates: 72747957-72749126 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

984 bp · TkA07G289880|TK1151|cDNA

ATGACACAAGTATTAGCCCCTGAGACCTCTGACGACTCAGTCCCTGAGACACCTCCCCACAATCCTCCACCACCACCTCCCTCACCGTCAACACATAAACCCCCATCACCACCACCAAATCAACCACCACCCCTACATAATCCCCCACCCAAAACCCCAACACCACCCTCCTCAAAGCATTCCTCTGCGAACTCCCCCCACTCTGGTGCTAGCAAACAGGGGGAGAACAAGGAAACAACAGCAGATGCTGAGTCAAATTT...

CDS

Download CDS FASTA

984 bp · TkA07G289880|TK1151|CDS

ATGACACAAGTATTAGCCCCTGAGACCTCTGACGACTCAGTCCCTGAGACACCTCCCCACAATCCTCCACCACCACCTCCCTCACCGTCAACACATAAACCCCCATCACCACCACCAAATCAACCACCACCCCTACATAATCCCCCACCCAAAACCCCAACACCACCCTCCTCAAAGCATTCCTCTGCGAACTCCCCCCACTCTGGTGCTAGCAAACAGGGGGAGAACAAGGAAACAACAGCAGATGCTGAGTCAAATTT...

Protein

Download Protein FASTA

327 aa · TkA07G289880|TK1151|PROTEIN

MTQVLAPETSDDSVPETPPHNPPPPPPSPSTHKPPSPPPNQPPPLHNPPPKTPTPPSSKHSSANSPHSGASKQGENKETTADAESNLNESTHDSDSDSDLYEMDISYVQGVPLLPEPIQGEDSDVEEEDPSILKRKTLTGPNTEETSSKRQKTTVNPAELAAQWGVSIDTVLEWLKENNQVQQQKKIENKDSRLIQRTLEHLGTFQDHIERFNRMTKIAAAEPQPSEPSNKESVLDKIYRARFANFQTRRISPDQIIRVR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G289880`
TK1151 ID	TkA07G289880
OH-1004 ID	LXL04_017224
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	57.400
Protein coverage (%)	TK1151 91.437 / OH-1004 48.581 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G289880`
Location	Chr07:72747957-72749126 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017224` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.868

Rank 1 · TkA07G289880 · TK1151

Cytoplasm0.241

Rank 2 · TkA07G289880 · TK1151

Mitochondrion0.033

Rank 3 · TkA07G289880 · TK1151

Cell membrane0.024

Rank 4 · TkA07G289880 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA07G289880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05984Cytomega_UL20A60-122 aa

PF05477SURF263-155 aa

PF05984Cytomega_UL20A116-191 aa

PF25289DUF7877127-155 aa

PF15978TnsD138-213 aa

PF17857AAA_lid_1167-209 aa

PF25289DUF7877169-199 aa

PF05477SURF2184-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G289880	`PF05984`	Cytomega_UL20A	60	122	6.7	7.8
TkA07G289880	`PF05477`	SURF2	63	155	1.9	8.7
TkA07G289880	`PF05984`	Cytomega_UL20A	116	191	6.7	7.8
TkA07G289880	`PF25289`	DUF7877	127	155	0.042	15.0
TkA07G289880	`PF15978`	TnsD	138	213	0.032	14.0
TkA07G289880	`PF17857`	AAA_lid_1	167	209	0.26	12.4
TkA07G289880	`PF25289`	DUF7877	169	199	0.042	15.0
TkA07G289880	`PF05477`	SURF2	184	196	1.9	8.7
TkA07G289880	`PF25289`	DUF7877	225	247	0.042	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card