RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G279600
Reference: TK1151 Chr: Chr07 Coordinates: 69928611-69933991 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3754 bp · TkA07G279600|TK1151|cDNA

GGATGAGCAAGTGATTGTGAAGGTACGGATTTATGCAGGGCTTAAACGAGCCCCCAAACTTCCTCTCTCGATTCAAAATTCAACAAAACTTTCATCCTCGTAAAATTAAATAAACCCTAATTGTGCACCAAAGACCACCAACAATCGCACCCTGCAGAGTTTTTGATTATATAAAGTTGATTGATGAGAAAATGAGTAATCGGCCGAGTACGCGCAACAAGAACAAGAGGCCAAGATCGGATAACAATGCAGAAGTCGTA...

CDS

Download CDS FASTA

3210 bp · TkA07G279600|TK1151|CDS

ATGAGTAATCGGCCGAGTACGCGCAACAAGAACAAGAGGCCAAGATCGGATAACAATGCAGAAGTCGTATCTGAATTATACAGGAAAATTCACTTGTCCAATGAAGTGTCAAAGGATGATATAAAGCAGCTATTTATGTTTGGGAAGCCAGTATGTCAAGGTTGCAGAGTAAACACAAAAGATAACCCCAACTGCTTTTGTGGGCTGATTCCACCTTCAAATGGCAACCGAAAATCTGGTTTATGGCAAAAGACATCAGA...

Protein

Download Protein FASTA

1069 aa · TkA07G279600|TK1151|PROTEIN

MSNRPSTRNKNKRPRSDNNAEVVSELYRKIHLSNEVSKDDIKQLFMFGKPVCQGCRVNTKDNPNCFCGLIPPSNGNRKSGLWQKTSEIVFSLGPDPSKDLRASLNTPAGLTNLGATCYANSILQFLYMNKSFREGVLCVEPEVLSKQPVLGQLARLFAQLHASKMAFIDSAPFIEALALDNGIQQDSHEFLTLLFSLLEQCLSSSQVSKARTVVQDLFRGGVSHVTKCSKCGNQSEASSNVEDFYGVELNVKGLKSLDES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G279600
TK1151 IDTkA07G279600
OH-1004 IDLXL04_029146
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.500
Protein coverage (%)TK1151 100.000 / OH-1004 97.894
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G279600
LocationChr07:69928611-69933991 (-)
DescriptionSimilar to UBP26: Ubiquitin carboxyl-terminal hydrolase 26
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g49600 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.
Control of DNA methylation and heterochromatic silencing by histone H2B deubiquitination.2007 · DOI: 10.1038/nature05864

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2XDG4 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. No verified direct reference in this release
Os03g0192800 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_029146 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006508 proteolysis Biological Process
GO:0016579 protein deubiquitination Biological Process
GO:0031647 regulation of protein stability Biological Process
GO:0048316 seed development Biological Process
GO:0005634 nucleus Cellular Component
GO:0005654 nucleoplasm Cellular Component
GO:0005730 nucleolus Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005929 cilium Cellular Component
GO:0004197 cysteine-type endopeptidase activity Molecular Function
GO:0004843 cysteine-type deubiquitinase activity Molecular Function
KEGG gene cross-reference
ath:AT3G49600
dosa:Os03g0192800
hsa:84196
rno:362636
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.740
Rank 1 · TkA07G279600 · TK1151
Cytoplasm0.321
Rank 2 · TkA07G279600 · TK1151
Mitochondrion0.058
Rank 3 · TkA07G279600 · TK1151
Cell membrane0.041
Rank 4 · TkA07G279600 · TK1151
Endoplasmic reticulum0.026
Rank 5 · TkA07G279600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00443UCH108-440 aa
PF13423UCH_1108-382 aa
PF27064YszA289-313 aa
PF13423UCH_1455-490 aa
PF06337DUSP519-578 aa
PF06337DUSP624-686 aa
PF21669SHLD2_OB1710-748 aa
PF06337DUSP752-838 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G279600PF00443UCH1084404.3e-50171.4
TkA07G279600PF13423UCH_11083823.3e-1660.5
TkA07G279600PF27064YszA2893130.2711.9
TkA07G279600PF13423UCH_14554903.3e-1660.5
TkA07G279600PF06337DUSP5195786.3e-2072.1
TkA07G279600PF06337DUSP6246866.3e-2072.1
TkA07G279600PF21669SHLD2_OB17107480.1812.2
TkA07G279600PF06337DUSP7528386.3e-2072.1
TkA07G279600PF00240ubiquitin9599960.03614.6
TkA07G279600PF21669SHLD2_OB1101010370.1812.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SCJ9Arabidopsis thalianasp|Q9SCJ9|UBP26_ARATH Ubiquitin carboxyl-terminal hydrolase 2657.800%Swiss-ProtHigh
A2XDG4Oryza sativa subsp. indicasp|A2XDG4|UBP26_ORYSI Ubiquitin carboxyl-terminal hydrolase 2658.600%Swiss-ProtHigh
A3AF13Oryza sativa subsp. japonicasp|A3AF13|UBP26_ORYSJ Ubiquitin carboxyl-terminal hydrolase 2658.700%Swiss-ProtHigh

JBrowse

View in Genome Browser