Gene Card
Gene overview
cDNA / CDS / Protein Sequences
939 bp · TkA07G279330|TK1151|cDNA
ATGGTACTTGCAGATTCTGGAAAGAGGATTGATGAGGTAGGGAGGAAGAAATACGTGAAGAAAGTGACAGGAAGGCATAATGACACGGACCTCCACTTAGCAGCCCAACGTGGTGATCTGGCGGCTGTGAAGCAAATCTTCGATGACATTGATTCTCAAATGGTGGGAGCTGATTTTGATACAGAAGTTGCAGAGATCCGAGCATCAATGGTGAATGAGGTGAATGAATTGGGAGAGACGGCCCTATATACAGCTTGTGA...
939 bp · TkA07G279330|TK1151|CDS
ATGGTACTTGCAGATTCTGGAAAGAGGATTGATGAGGTAGGGAGGAAGAAATACGTGAAGAAAGTGACAGGAAGGCATAATGACACGGACCTCCACTTAGCAGCCCAACGTGGTGATCTGGCGGCTGTGAAGCAAATCTTCGATGACATTGATTCTCAAATGGTGGGAGCTGATTTTGATACAGAAGTTGCAGAGATCCGAGCATCAATGGTGAATGAGGTGAATGAATTGGGAGAGACGGCCCTATATACAGCTTGTGA...
Protein
Download Protein FASTA312 aa · TkA07G279330|TK1151|PROTEIN
MVLADSGKRIDEVGRKKYVKKVTGRHNDTDLHLAAQRGDLAAVKQIFDDIDSQMVGADFDTEVAEIRASMVNEVNELGETALYTACERGHLEVVRELLKYSNKVTIMRKNRFLFDPLHVAAIQGHHAVVQLLLDHDASLCQTISVRNITPLITAAVRGHTAVVHELLLKDLSMLDVARSDGKNALNLAARTSHVEIIKTLLEKSPHLALRTDKKRQIALHMAAKGKRAEIVKELLIVPHININALTRDCKTAFDIVDGLP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G279330 |
|---|---|
| TK1151 ID | TkA07G279330 |
| OH-1004 ID | LXL04_029145 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 77.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 52.504Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G279330 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:69863653-69864693 (-) | ||||||||||||
| Description | Similar to ITN1: Ankyrin repeat-containing protein ITN1 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0009651 response to salt stress Biological Process GO:0009741 response to brassinosteroid Biological Process GO:0009826 unidimensional cell growth Biological Process GO:0010183 pollen tube guidance Biological Process GO:0010483 pollen tube reception Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009506 plasmodesma Cellular Component GO:0016324 apical plasma membrane Cellular Component GO:0043680 filiform apparatus Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT3G04690 ath:AT3G12360 ath:AT3G46290 ath:AT5G28680 dosa:Os01g0837000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF24521Ank_KRIT126-48 aaPF13857Ank_529-44 aaPF12796Ank_231-140 aaPF00023Ank31-45 aaPF13637Ank_431-44 aaPF13637Ank_431-95 aaPF13606Ank_331-48 aaPF03158DUF24972-105 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G279330 | PF24521 | Ank_KRIT1 | 26 | 48 | 1.2e-10 | 42.1 |
| TkA07G279330 | PF13857 | Ank_5 | 29 | 44 | 1.8e-23 | 83.1 |
| TkA07G279330 | PF12796 | Ank_2 | 31 | 140 | 1.7e-30 | 106.1 |
| TkA07G279330 | PF00023 | Ank | 31 | 45 | 1.1e-25 | 88.9 |
| TkA07G279330 | PF13637 | Ank_4 | 31 | 44 | 6.8e-24 | 84.1 |
| TkA07G279330 | PF13637 | Ank_4 | 31 | 95 | 6.8e-24 | 84.1 |
| TkA07G279330 | PF13606 | Ank_3 | 31 | 48 | 7.8e-22 | 75.5 |
| TkA07G279330 | PF03158 | DUF249 | 72 | 105 | 0.15 | 12.5 |
| TkA07G279330 | PF13857 | Ank_5 | 75 | 100 | 1.8e-23 | 83.1 |
| TkA07G279330 | PF00023 | Ank | 78 | 100 | 1.1e-25 | 88.9 |
| TkA07G279330 | PF13606 | Ank_3 | 78 | 103 | 7.8e-22 | 75.5 |
| TkA07G279330 | PF24521 | Ank_KRIT1 | 78 | 170 | 1.2e-10 | 42.1 |
| TkA07G279330 | PF13637 | Ank_4 | 84 | 133 | 6.8e-24 | 84.1 |
| TkA07G279330 | PF13857 | Ank_5 | 107 | 138 | 1.8e-23 | 83.1 |
| TkA07G279330 | PF00023 | Ank | 116 | 141 | 1.1e-25 | 88.9 |
| TkA07G279330 | PF13606 | Ank_3 | 116 | 138 | 7.8e-22 | 75.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.