TkA07G279210 | RubberDandelionOmics

Gene overview

TkA07G279210

Reference: TK1151 Chr: Chr07 Coordinates: 69825991-69831007 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

676 bp · TkA07G279210|TK1151|cDNA

AAAAACCCAAAACCCTAGCCAATTGTGCTTCCCCTGCTTTCCTATTTCTGGTAAAACCCTCCCAAAACCCTGCCAATCACAATCCTTGTCTCTCGCCCTGTGAAAATGCCTTTGGGAGATAATCTAGGAGACAAAAGCGACTCCAGATACTGTGGAGTAGAGACTGACTTCAATGATGACATGCCTCATGTTCTTTCCCATAACATTAATGGCGGTTTTGATTTCGTCGTAGCTCCATTGATGGAACCTGCATACAGACC...

CDS

Download CDS FASTA

1947 bp · TkA07G279210|TK1151|CDS

ATGCCTTTGGGAGATAATCTAGGAGACAAAAGCGACTCCAGATACTGTGGAGTAGAGACTGACTTCAATGATGACATGCCTCATGTTCTTTCCCATAACATTAATGGCGGTTTTGATTTCGTCGTAGCTCCATTGATGGAACCTGCATACAGACCTAGCTTAATTGATAGTGCTAGCAGGGACTCCAGTGTGCTTCCTTTTGCTGGATCAGATTTGGTTTTAAGTCCATCACAATGGAGTAGTCATGTTGTTGGCAAGAT...

Protein

Download Protein FASTA

648 aa · TkA07G279210|TK1151|PROTEIN

MPLGDNLGDKSDSRYCGVETDFNDDMPHVLSHNINGGFDFVVAPLMEPAYRPSLIDSASRDSSVLPFAGSDLVLSPSQWSSHVVGKISSWIDLDSEDETLREDSEIALKQELAWASHLSLQACLLPTPKGRSCGNYARCVNQILQNLNNMQLWLRIHLEKSDGDDDSVNGVTDRMAVDLSDSWELWNSFRVLCEHHSQLSVALDVLSSLPSPNSLGRWIGEPVKSAILHTDSFLTNARGYPCLSKRHQNLLSSFFYYSVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G279210`
TK1151 ID	TkA07G279210
OH-1004 ID	LXL04_029142
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G279210

Location Chr07:69825991-69831007 (+)

Description Similar to PMRT15: Protein arginine N-methyltransferase 1.5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31120`	Methylates arginine residues of myelin basic protein (MBP) in vitro.	SKB1-mediated symmetric dimethylation of histone H4R3 controls flowering time in Arabidopsis.2007 · DOI: 10.1038/sj.emboj.7601647

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0139200`	Methylates arginine residues in proteins such as histone H4.	No verified direct reference in this release
`UniProt: A2X0Q3`	Methylates arginine residues in proteins such as histone H4.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029142 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000387 spliceosomal snRNP assembly Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006353 DNA-templated transcription termination Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007088 regulation of mitotic nuclear division Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010220 positive regulation of vernalization response Biological Process

GO:0018216 peptidyl-arginine methylation Biological Process

GO:0032259 methylation Biological Process

GO:0032922 circadian regulation of gene expression Biological Process

KEGG gene cross-reference

ath:AT4G31120

dosa:Os02g0139200

hsa:10419

pon:100173581

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.553

Rank 1 · TkA07G279210 · TK1151

Cytoplasm0.480

Rank 2 · TkA07G279210 · TK1151

Mitochondrion0.050

Rank 3 · TkA07G279210 · TK1151

Cell membrane0.050

Rank 4 · TkA07G279210 · TK1151

Endoplasmic reticulum0.040

Rank 5 · TkA07G279210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17285PRMT5_TIM37-302 aa

PF23233HAT_Syf1_CNRKL1_N142-192 aa

PF05185PRMT5308-477 aa

PF02475TRM5-TYW2_MTfase360-450 aa

PF13649Methyltransf_25376-474 aa

PF13847Methyltransf_31377-484 aa

PF17286PRMT5_C480-646 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G279210	`PF17285`	PRMT5_TIM	37	302	5.1e-82	275.7
TkA07G279210	`PF23233`	HAT_Syf1_CNRKL1_N	142	192	0.14	12.6
TkA07G279210	`PF05185`	PRMT5	308	477	3.5e-74	249.0
TkA07G279210	`PF02475`	TRM5-TYW2_MTfase	360	450	2.1e-06	28.5
TkA07G279210	`PF13649`	Methyltransf_25	376	474	0.00017	22.9
TkA07G279210	`PF13847`	Methyltransf_31	377	484	8.5e-06	26.3
TkA07G279210	`PF17286`	PRMT5_C	480	646	1e-61	208.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWT4`	Arabidopsis thaliana	sp\|Q8GWT4\|ANM15_ARATH Protein arginine N-methyltransferase 1.5	74.400%	Swiss-Prot	High
`Q6YXZ7`	Oryza sativa subsp. japonica	sp\|Q6YXZ7\|ANM5_ORYSJ Protein arginine N-methyltransferase 5	73.200%	Swiss-Prot	High
`A2X0Q3`	Oryza sativa subsp. indica	sp\|A2X0Q3\|ANM5_ORYSI Protein arginine N-methyltransferase 5	73.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card