TkA07G275740 | RubberDandelionOmics

Gene overview

TkA07G275740

Reference: TK1151 Chr: Chr07 Coordinates: 68958114-68964222 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1691 bp · TkA07G275740|TK1151|cDNA

AAACCCTGTGGATGTATTAAAAAGTGCCGTGGATTTATCAACTCTCACAAAAGAAACCATTTTATCAACTCCCCCGATAACTGCCGAAATCCGATTTTTCATTTGCTCGATTTCCCCCCACAAACTAAAAGCACCGTTGCCAGTCGTTCTACTTCGCCCTTACTAACCAATTTTCTCACCATGGATTCCGGTCCTCAGTCTGCTGTAGACGGCGGCGGCACCAGATCCGGTGGAAAAGTCTATAAACGTAGGCGAACTTC...

CDS

Download CDS FASTA

1236 bp · TkA07G275740|TK1151|CDS

AAACCCTGTGGATGTATTAAAAAGTGCCGTGGATTTATCAACTCTCACAAAAGAAACCATTTTATCAACTCCCCCGATAACTGCCGAAATCCGATTTTTCATTTGCTCGATTTCCCCCCACAAACTAAAAGCACCGTTGCCAGTCGTTCTACTTCGCCCTTACTAACCAATTTTCTCACCATGGATTCCGGTCCTCAGTCTGCTGTAGACGGCGGCGGCACCAGATCCGGTGGAAAAGTCTATAAACGTAGGCGAACTTC...

Protein

Download Protein FASTA

411 aa · TkA07G275740|TK1151|PROTEIN

KPCGCIKKCRGFINSHKRNHFINSPDNCRNPIFHLLDFPPQTKSTVASRSTSPLLTNFLTMDSGPQSAVDGGGTRSGGKVYKRRRTSVRKTPYDRPTPPPQPESPKWFSGLVYPAKFVAGGASKLLSSIWNPNSWGSHSSSSDSDSDSGAIEDDPEDNGNLSEAGAELNQSQGSSSGKSEILYLVGQLLMLEHYSREECDRLIEITKSRVVDYTMGEGVDAGPKGPDIHSHVILDARKLISENMVGPSSKSNMENHIHSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G275740`
TK1151 ID	TkA07G275740
OH-1004 ID	LXL04_025932
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	43.600
Protein coverage (%)	TK1151 64.477 / OH-1004 81.013 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G275740

Location Chr07:68958114-68964222 (-)

Description Similar to KAKU4: Protein KAKU4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31430`	Required for nucleus structure organization (e.g. size and shape).	The Novel Nuclear Envelope Protein KAKU4 Modulates Nuclear Morphology in Arabidopsis.2014 · DOI: 10.1105/tpc.113.122168

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025932 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0071763 nuclear membrane organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005637 nuclear inner membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT4G31430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.552

Rank 1 · TkA07G275740 · TK1151

Cytoplasm0.340

Rank 2 · TkA07G275740 · TK1151

Cell membrane0.164

Rank 3 · TkA07G275740 · TK1151

Endoplasmic reticulum0.113

Rank 4 · TkA07G275740 · TK1151

Plastid0.043

Rank 5 · TkA07G275740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08564CDC37_C298-364 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G275740	`PF08564`	CDC37_C	298	364	0.032	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q949W6`	Arabidopsis thaliana	sp\|Q949W6\|KAKU4_ARATH Protein KAKU4	32.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card