TkA07G272100 | RubberDandelionOmics

Gene overview

TkA07G272100

Reference: TK1151 Chr: Chr07 Coordinates: 68017919-68019808 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

880 bp · TkA07G272100|TK1151|cDNA

ATGGGCATGGACAGATGCCTGGAAGACACAGAGAGCTGGAGCAGTACTGGGGGGAGTCACAGTCTCAAGCGCATGCAGATGGGTGGGCTGATGAATTTGCTGGGCAACAGAGACACAATCCTAATGCTTGGGCTTTATCTTTCGAACGCCAACATGGAGCTGGGGGCTGGGCTTCTGAGTTTGAGCATGGTTGATGATTTGTCAAGAATGTTCAGACTATTTTCAAAAATACCTCATGGATTGAATCCTGTCTCTACTAT...

CDS

Download CDS FASTA

810 bp · TkA07G272100|TK1151|CDS

ATGGGCATGGACAGATGCCTGGAAGACACAGAGAGCTGGAGCAGTACTGGGGGGAGTCACAGTCTCAAGCGCATGCAGATGGGTGGGCTGATGAATTTGCTGGGCAACAGAGACACAATCCTAATGCTTGGGCTTTATCTTTCGAACGCCAACATGGAGCTGGGGGCTGGGCTTCTGAGTTTGAGCATGGTTGATGATTTGTCAAGAATGTTCAGACTATTTTCAAAAATACCTCATGGATTGAATCCTGTCTCTACTAT...

Protein

Download Protein FASTA

269 aa · TkA07G272100|TK1151|PROTEIN

MGMDRCLEDTESWSSTGGSHSLKRMQMGGLMNLLGNRDTILMLGLYLSNANMELGAGLLSLSMVDDLSRMFRLFSKIPHGLNPVSTMFKQHVCAEGTALVKQAEDAASNKKAEKRDVVGLQKKLIFLKFQWPENLHIGVIYNYNLNRVGQETIHWKMVAKICLQLGYAKQLCLGALSGNSECRSRSFFFSYSIGLDAIVLPLHGSLPPEMQQAFHHLSTSLWGQFGPFVSFGRILQQQGNFLIWGQQFGWSLMKLARVFW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G272100`
TK1151 ID	TkA07G272100
OH-1004 ID	LXL04_025986
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.200
Protein coverage (%)	TK1151 24.164 / OH-1004 8.632 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G272100

Location Chr07:68017919-68019808 (-)

Description Similar to CUL1: Cullin-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02570`	Involved in ubiquitination and subsequent proteasomal degradation of target proteins.	Null mutation of AtCUL1 causes arrest in early embryogenesis in Arabidopsis.2002 · DOI: 10.1091/mbc.e02-02-0077 Arabidopsis CAND1, an unmodified CUL1-interacting protein, is involved in multiple developmental pathways controlled by ubiquitin/proteasome-mediated protein Degradation.2004 · DOI: 10.1105/tpc.021949
`At1g43140`	Putative cullin-like protein 1.	No verified direct reference in this release
`At1g02980`	Core component of multiple SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0369000`	Involved in ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025986 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0006950 response to stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010265 SCF complex assembly Biological Process

KEGG gene cross-reference

ath:AT1G02980

ath:AT1G43140

ath:AT4G02570

ddi:DDB_G0284903

dosa:Os01g0369000

osa:4325735

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.470

Rank 1 · TkA07G272100 · TK1151

Nucleus0.378

Rank 2 · TkA07G272100 · TK1151

Mitochondrion0.151

Rank 3 · TkA07G272100 · TK1151

Endoplasmic reticulum0.102

Rank 4 · TkA07G272100 · TK1151

Cell membrane0.082

Rank 5 · TkA07G272100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00888Cullin58-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G272100	`PF00888`	Cullin	58	113	6.7e-07	29.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AH6`	Arabidopsis thaliana	sp\|Q94AH6\|CUL1_ARATH Cullin-1	63.000%	Swiss-Prot	Low
`P0CH31`	Arabidopsis thaliana	sp\|P0CH31\|CLL1_ARATH Putative cullin-like protein 1	58.500%	Swiss-Prot	Low
`Q9SRZ0`	Arabidopsis thaliana	sp\|Q9SRZ0\|CUL2_ARATH Cullin-2	57.100%	Swiss-Prot	Low
`Q5ZC88`	Oryza sativa subsp. japonica	sp\|Q5ZC88\|CUL1_ORYSJ Cullin-1	70.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card